KEGG   Aspergillus fumigatus: AFUA_2G07870
Entry
AFUA_2G07870      CDS       T01017                                 

Definition
(RefSeq) Patatin-like serine hydrolase
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: Patatin
Other DBs
NCBI-GeneID: 3513196
NCBI-ProteinID: XP_755122
UniProt: Q4X231
Position
2
AA seq 625 aa
MDSVTLRRKDTTKGPPLRVLSLDGGGVRGYSMLIILQELMYRIYVETEGKPPRRDQIPKP
CDHFDLIVGTGTGGLIALMLGRLRLDLETCKEVYVRMTRRVFETDKTIAGIPYRSTLFKA
SKLEEAIRECVREHTVFEAEGNDMPNASSRNSIASAPYSPAAIPQRSVSRGSFSTSGASH
PSTPISQRHSAIINGLRWGNPDALLYDNRENRTKTAVTALYKGTPRNGSAVLLRSYDSRK
EPPPEFNCTIWQAGRATSATGLAFKPIQIGQHVFIDEGAGTYNPAPQVLDEAAVNEWPGR
EIGVFISVGTGKRPPGTNSRQHEWWEDFFGDALGTFAEARRRLIAKIEGCEEIHQEMLRT
HLAKRGVNKDNYYRLNVEVGVGEFGMNEWNRLADISTNTRRYLSKPEVKKSIMDAGVKFA
KIERMHRRLAAHAAAGYDPSTEPTEDPPFSPHSYTSQGSVFSVPPPSNPMAVELPAELPG
DFAPIMTHQPPSSGLRVPSPPAEDALPLHPTPQDGVYPSPGRVSSSSFSYTHSDGSRPGS
QQQMASPRLSVEQVQVQAPESNIPPPVPPKTPIPYPDNANEALMPMPLMVHHGRNGSTGK
VRPPYPVDEPPPAVNKQRKPSYHVR
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggactctgtgacgttacgtcgcaaagacacgaccaagggccctccgctgagggttctg
tcgttagatggaggaggcgttcgaggatactcgatgctcatcattctccaggaactcatg
taccgcatctacgtcgagactgaaggcaaacccccgcgccgagaccagatccccaagccc
tgcgaccacttcgacctcatcgttggcaccggcacgggcggcctcatcgccctcatgctg
ggtcggctacgtctcgacctggaaacctgcaaggaagtctatgtacgcatgacccggcgc
gttttcgaaaccgacaagaccatcgccggcatcccctaccggtcgaccttgttcaaggcg
tcgaaattggaagaggcgatccgggaatgtgtgcgggaacatacggtattcgaggccgag
gggaatgatatgcccaatgccagttcgcgcaactccattgccagcgcgccctacagtccc
gccgcgattccgcagcgctccgtgagtagaggcagtttcagcacgtctggcgcttcgcat
ccctcgacgccgatcagtcagcggcattccgctatcatcaacgggctacggtgggggaac
ccggatgctctgctctacgataatcgggaaaatcggacaaagactgccgtgacggcgttg
tacaaaggcaccccccgcaacggatccgcggtgctgctgcgatcatacgactcgcgtaaa
gagcctccccccgaattcaactgcactatctggcaagccggccgcgccacgtcggcgaca
ggtctggcgtttaagccgattcaaatcggacagcatgtgtttatcgatgagggtgcaggg
acatataatccggcgccgcaggtcctggatgaagcggctgtcaacgagtggcctgggcgg
gaaatcggggtgtttatcagcgtgggtacgggcaagcgtccgccgggcaccaacagtcgg
cagcatgagtggtgggaagatttttttggggatgctctcggcacatttgccgaggcgcga
cgacgactgatcgccaagatcgagggttgcgaggagattcatcaggagatgcttcgcact
cacctggccaagcgcggggtgaacaaggacaactactaccggctgaatgtcgaggttggc
gtgggtgagtttggcatgaacgagtggaaccgactggccgacatcagcaccaatacgcga
cgctacctgtccaagcccgaagtcaagaaaagcatcatggatgccggggtcaagttcgca
aagatcgagcgcatgcaccggcgactggctgcgcatgcggccgcaggatatgatccctct
accgagccgacggaagatccgccattctcgcctcacagctacacttcgcaaggatcggta
ttttccgttccgccaccatccaaccccatggcggtggaattgcccgcggagctccctggt
gactttgcgcccatcatgacacatcagcctccgtcgagcggcttgcgggttccgtcccct
ccggctgaggacgcgctaccgctgcatccgaccccgcaggatggcgtctatccttcgcca
ggacgagtttccagcagtagcttcagttacactcacagcgatgggagtcggccgggctcg
cagcaacaaatggcgtcgcctcggctgagcgtggagcaggtgcaggtgcaggcgccggag
agcaacataccacctccagtgccgccaaagaccccgattccgtaccctgataatgcgaat
gaggcgctgatgccgatgcccttgatggtgcatcatggtcggaatgggtctactgggaag
gtccggcccccttatcccgttgatgagcctcctcccgcggtaaacaaacagcggaaaccc
agttatcatgtgcgatga

DBGET integrated database retrieval system