KEGG   Aspergillus fumigatus: AFUA_2G08550Help
Entry
AFUA_2G08550      CDS       T01017                                 

Definition
(RefSeq) peptidyl-prolyl cis/trans isomerase
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:afm03021]
    AFUA_2G08550
   03110 Chaperones and folding catalysts [BR:afm03110]
    AFUA_2G08550
Enzymes [BR:afm01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AFUA_2G08550
Transcription machinery [BR:afm03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     AFUA_2G08550
Chaperones and folding catalysts [BR:afm03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    AFUA_2G08550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase Rotamase_3 WW Rotamase_2 MAM
Motif
Other DBs
NCBI-GeneID: 3513345
NCBI-ProteinID: XP_755189
UniProt: Q4X1W4
Position
2
AA seq 175 aa AA seqDB search
MVETGLPAGWEVRHSNSKNLPYYFNPSTKESRWEPPSGTDTELLKVYMANYHSAPAGRPD
GTAQGEGKIRCSHLLIKHRDSRRPSSWREAEITRSKEEAIEILRGHEQRIRSGEVSLGDI
AVSESDCSSARKKGDLGFFGRGEMQKEFEDAAFALQPGQVSGIVETASGVHLIER
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaactggtcttcctgcggggtgggaggttcgccattccaactccaagaacctt
ccgtactacttcaatccctcgactaaggagtcccggtgggagcctcccagcggcacagac
accgagttgctcaaggtctacatggcaaactaccacagcgcccctgccgggcggcctgat
ggcacagcccagggcgagggcaagatccgttgcagtcaccttctgattaagcatagagac
agtaggcggccaagcagctggcgggaggcagagatcacccgatcgaaggaggaagcgatc
gagatccttcgaggtcatgaacagcgcatccgctcgggtgaagttagcttaggtgatatc
gcagtctcagagtcggattgtagcagtgccaggaagaagggcgaccttgggtttttcggc
cgtggcgagatgcaaaaggaattcgaggatgccgcctttgcgctgcagccaggccaggtc
agcggcattgttgagacggcctctggtgtccaccttattgaacggtaa

DBGET integrated database retrieval system