KEGG   Aspergillus fumigatus: AFUA_2G11240Help
Entry
AFUA_2G11240      CDS       T01017                                 

Definition
(RefSeq) UDP-N-acetyl-glucosamine-1-P transferase Alg7
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
afm  Aspergillus fumigatus
Pathway
afm00510  N-Glycan biosynthesis
afm01100  Metabolic pathways
Module
afm_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    AFUA_2G11240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:afm01003]
    AFUA_2G11240
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     AFUA_2G11240
Glycosyltransferases [BR:afm01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   AFUA_2G11240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-GeneID: 3512883
NCBI-ProteinID: XP_755457
UniProt: Q4X146
Position
2
AA seq 468 aa AA seqDB search
MNSAYASSLSRRETWRLLVLAGAGIGIIVNSLQGDGAPLIASIAFSAVAFALTFSLIRWL
GPVFMRAGLKGKDMAKPRRPEIPETMGAVCAVVYLLALIFFIPFAFYKDIVAATSGGGNR
DVVLEIAHVENGRFLHRFPHSKLASYLSGLLSLQCIVILGIGDDLLDIRWRHKVLIPAFG
AIPMLIVYFVDFGVTHVVVPVPLQPYLGTFVDLGWLYYVYMAAIAIFCPNAINMLAGING
VEVAQSLVIAVLLVANDLLYIAPTTPFPHPATDSHLFSLYFLLPFIGVSVALLCHNWYPS
KVFVGDTYCYFAGMVFAVVGILGHFSKTLLLLFIPQIFNFLYSTPQLFHIIPCPRHRLPK
FNAMSGLLDASVTEWTVPPGPLVATGLEILHRMRLIRITKNEEGEIVESTNLTILNLWLI
WMGPMREDRLAWHMVMVQTACGALGLFVRHRLALLVFQQDNRAFRYGV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaactcagcatatgcaagttcactttctcgtcgggagacctggcgtctcttggtactg
gcgggagcaggtattggaatcatcgtgaatagtcttcaaggtgacggcgcacctctaatc
gcatccattgcttttagcgcagttgcttttgcattgacgttcagtctaattcgatggctg
ggaccggttttcatgagagctggcctaaagggaaaggacatggcgaagccaagaagacct
gaaataccggagacgatgggggctgtttgcgcagttgtgtatcttctggcgctcatcttc
ttcattccctttgccttttataaggacatcgttgcagctacttcaggtggtggtaaccga
gatgtagtgcttgagattgctcatgtcgagaatggtcgctttctccatcgctttccacac
tccaagcttgcgtcttatctgtcggggctcctctcgttgcaatgtattgtcatactagga
attggggatgatctgctcgatatacgctggagacacaaagtcctcattcctgcattcggt
gcaatcccaatgctcattgtttactttgtggacttcggggttacgcatgttgtcgtgccg
gtgcccctgcagccgtatttgggcactttcgtggacttgggatggctgtactatgtgtac
atggccgctattgccatattttgtcccaacgccatcaacatgctggcggggatcaacgga
gtggaagttgcacaatcactcgtaattgcggtgctactggttgcgaatgacctgttatac
attgcccctacaacgccattcccgcacccggctaccgactcgcatctattttctttatac
ttcctgctccctttcatcggggtttcagtggccttgctgtgccacaactggtatccatcg
aaggtgtttgtgggcgatacctactgctactttgcggggatggtgtttgccgtggtgggg
attctcggccatttcagcaaaaccctcctgctgctcttcattccacagatcttcaacttt
ctgtattcgactccgcagctcttccacatcatcccttgtccccgtcaccgcctccccaag
ttcaacgccatgagcgggttgttggacgcatccgtgactgagtggaccgtgcctcccggc
ccattggtagccactggcctagagatcctgcacaggatgcggctgattcgcattacaaag
aacgaggagggtgagatcgtcgagtcgaccaatctgacgatcctgaatttgtggctcatt
tggatgggtccgatgcgggaggatcgtttggcgtggcacatggtcatggttcagaccgcc
tgtggggccctgggcttgttcgtacgacatcgtctggcgttgttggtgtttcagcaagat
aatagagcatttcgatacggcgtatag

DBGET integrated database retrieval system