KEGG   Aspergillus fumigatus: AFUA_2G11470
Entry
AFUA_2G11470      CDS       T01017                                 

Definition
(RefSeq) hypothetical protein
Organism
afm  Aspergillus fumigatus
SSDB
Other DBs
NCBI-GeneID: 5076982
NCBI-ProteinID: XP_001481668
UniProt: A4D9A8
Position
2
AA seq 419 aa
MSRYDDYRSSSERMERTRERRYSRPPVIDRPRRSEEERFESRLHELDRYGPPARRSDRFY
EDDHLLHNSGPLVTYERSRGDSPPPRPRLLRRQSSLDTFDRIPSRKLGEYYIRGHLPREP
RAPSIPRRRPSRRHRETEYYEDIRIAEPDYYGDEEFRILQERDRYAAHPRRSTGRVREEV
VEEVEYEKPYPRKGKTRMPRRLVHSLAIKKLGYPYEEEDDRITIQLALSKEQIDEVISLS
REIRRQTETRTIYTRRSPSPIRARPRERTVERLTMETYSPRATQDTLIIERSPSRHRSPS
RHYELSEKRVTRAVSRTRSISVHGRRHGLSSPVRMVERYDDQVDFDKRDTGPLAIVVRPR
DSDDDLRELRRLEISERDEKIRNTQLALPSGEMEEITEVRKDRRGPNPRILRAMMATLT
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgtcgcggtacgatgactaccgctcctcctccgaaaggatggagcgcactcgagagcgc
cgttattctcggcctcctgtcatcgaccgtccccgtcggtctgaagaagagcgctttgaa
tcccgcctacatgagcttgaccgatacggtcctcctgcccgccggtcggacagattctac
gaggacgatcatctgcttcataactcgggtccgctggtcacctacgagcggtcgcgcggg
gacagccctcctccgcgccctcgcttgctacgtcgccaatcttccttggatacgtttgac
cgcatcccttcgcgcaagctaggtgaatactacatccgcgggcatctgcctcgcgagccg
cgtgcgccttctattccccggagacgtccctcccgcagacacagagagactgagtattac
gaagacattcgcatcgcggagccagattactacggcgacgaggagttccggatcctccag
gagcgagatcggtacgcggctcatccgcgccggtcgaccggtcgcgttcgcgaggaagta
gttgaagaggttgaatacgagaagccgtatccccgcaagggcaagactcgcatgccacga
agactggtgcactcacttgcgatcaaaaagttgggatatccgtatgaggaagaggatgac
cgaatcacgattcagttggctctctcaaaagagcagattgatgaagtcatcagcctgagt
cgggagatcaggcgccagacagaaactcggaccatatatactcgccgttccccgtcgccg
attcgtgcgcggccaagagagagaactgtcgagcgacttacgatggagacctattccccc
cgagccacccaggatacattgatcatcgaaagatcgccctcccgccaccgatctccatcg
cgccattacgagctcagcgagaagcgagtgacgagggctgtctcccgtacccgatcaata
tcagtccatgggcgccgtcacggactctcctctccagtacggatggtggagcgatatgat
gatcaggtcgattttgacaagagggataccggccctcttgccatcgtcgtgcgccctcga
gacagtgacgatgatcttcgcgagctcagacgattggagataagtgaacgagacgaaaag
atccgtaacacccagcttgcccttcccagtggtgagatggaggagattaccgaggtgagg
aaggaccgcagaggtcccaatccccgaatcctccgcgcaatgatggcaaccctaacctga

DBGET integrated database retrieval system