KEGG   Aspergillus fumigatus: AFUA_2G12560Help
Entry
AFUA_2G12560      CDS       T01017                                 

Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase family protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
afm  Aspergillus fumigatus
Pathway
afm00790  Folate biosynthesis
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AFUA_2G12560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afm04147]
    AFUA_2G12560
Enzymes [BR:afm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     AFUA_2G12560
Exosome [BR:afm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFUA_2G12560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a Trypan_PARP DUF3306 CCDC53 DDHD Presenilin Connexin Serinc Plasmodium_Vir RR_TM4-6 DUF913 NPR3 SpoIIP CPSF100_C
Motif
Other DBs
NCBI-GeneID: 3512968
NCBI-ProteinID: XP_755588
UniProt: Q4X0R5
Position
2
AA seq 268 aa AA seqDB search
MDAARGVLQRRVRACISRPGVLSGRVIYPSLWLSSSLSSLSSSVRARSSPRTTVSPLRGG
ALREGRGLLTPVMAGAGVGYSTTTGASGEQEQEQEKAQEQEQEQEPEKAQEQEQEQEPEK
AQEQELEQGQEPEKPQVQISQGEDAEQVQGGLERLLENGWVLDGERMGIKKTFYFRSYFK
AVSFLNVVASQSATKKHHPTMTVRIGSVDVHWTTHNPRGLSSKDIAMAEHCEEGAQLMGA
VDEAKGKKCSLPAVTLLGTPTREREHEA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagcgcggggagttctgcaacgccgggtgcgggcttgcatctctcgtcccggt
gttttgtctggtagagtcatttatccatcattgtggctgtcttcgtcgttgtcgtcattg
tcatcatccgttcgggcgcggagttctccccgcacgacggtctctccgctccgcggcggt
gcgctccgtgaggggagggggttgcttacacctgtgatggcgggtgcgggtgtgggttac
tcgactactactggtgcttctggggagcaggagcaagagcaggagaaggcgcaagaacag
gagcaggaacaggagccagagaaggcgcaggaacaggaacaggaacaggagccagagaag
gcgcaggaacaggagctggagcaggggcaggagccggagaagccgcaggtgcagatctcg
cagggtgaggatgcagaacaggttcaggggggattggaacgcttgcttgagaacgggtgg
gtgttggacggggagagaatgggaatcaaaaagacgttttattttcggtcttattttaag
gctgtgagctttttgaatgtggttgcgtcgcagagcgcgacaaagaagcatcatccgacc
atgactgttaggattggaagtgtggatgtgcattggacgacgcataatccgcgaggactg
tcgtcgaaagacattgctatggcggagcattgtgaggagggagcgcagttgatgggggct
gttgacgaggcgaaggggaagaagtgctcgctgcccgcggtgactttgctgggaactccc
acgcgtgagcgtgagcatgaagcctag

DBGET integrated database retrieval system