KEGG   Aspergillus fumigatus: AFUA_3G02270Help
Entry
AFUA_3G02270      CDS       T01017                                 

Definition
(RefSeq) mycelial catalase Cat1
  KO
K03781  catalase [EC:1.11.1.6]
Organism
afm  Aspergillus fumigatus
Pathway
afm00380  Tryptophan metabolism
afm00630  Glyoxylate and dicarboxylate metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
afm01200  Carbon metabolism
afm04011  MAPK signaling pathway - yeast
afm04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AFUA_3G02270
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AFUA_3G02270
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    AFUA_3G02270
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AFUA_3G02270
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     AFUA_3G02270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel
Motif
Other DBs
NCBI-GeneID: 3506033
NCBI-ProteinID: XP_748550
UniProt: Q92405
Position
3
AA seq 728 aa AA seqDB search
MRLTFIPSLIGVANAVCPYMTGELNRRDEISDGDAAAATEEFLSQYYLNDNDAFMTSDVG
GPIEDQNSLSAGERGPTLLEDFIFRQKIQRFDHERVPERAVHARGAGAHGVFTSYGDFSN
ITAASFLAKEGKQTPVFVRFSTVAGSRGSSDLARDVHGFATRFYTDEGNFDIVGNNIPVF
FIQDAILFPDLIHAVKPRGDNEIPQAATAHDSAWDFFSQQPSTMHTLLWAMSGHGIPRSF
RHVDGFGVHTFRFVTDDGASKLVKFHWKSLQGKASMVWEEAQQTSGKNPDFMRQDLHDAI
EAGRYPEWELGVQIMDEEDQLRFGFDLLDPTKIVPEEFVPITKLGKMQLNRNPRNYFAET
EQVMFQPGHIVRGVDFTEDPLLQGRLFSYLDTQLNRHGGPNFEQLPINQPRVPVHNNNRD
GAGQMFIPLNPHAYSPKTSVNGSPKQANQTVGDGFFTAPGRTTSGKLVRAVSSSFEDVWS
QPRLFYNSLVPAEKQFVIDAIRFENANVKSPVVKNNVIIQLNRIDNDLARRVARAIGVAE
PEPDPTFYHNNKTADVGTFGTKLKKLDGLKVGVLGSVQHPGSVEGASTLRDRLKDDGVDV
VLVAERLADGVDQTYSTSDAIQFDAVVVAAGAESLFAASSFTGGSANSASGASSLYPTGR
PLQILIDGFRFGKTVGALGSGTAALRNAGIATSRDGVYVAQSVTDDFANDLKEGLRTFKF
LDRFPVDH
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcacgttcatccccagcctcattggcgttgccaatgcggtatgtccctatatg
accggcgagctcaaccgtcgtgatgagatatccgatggcgacgctgccgcagccacagag
gaattcttgtcccagtattatctcaacgacaatgatgccttcatgacgtccgacgtgggc
ggccctatcgaagatcagaatagtctcagtgccggagagcgtggtcccaccctgctcgaa
gatttcattttccgtcaaaagatacagcgtttcgaccatgaacgggtccccgagcgtgcg
gtccatgcccgtggtgccggcgcccatggagtcttcacttcatatggcgacttctcgaac
atcactgcggcttctttcctggccaaggaaggcaagcaaacccctgtatttgtccgcttc
tcgacggtcgcaggaagcagaggtagttcggatctggcccgtgatgttcacggttttgcc
actcgtttctataccgacgagggcaatttcgatatcgttggaaacaatatccctgtattc
ttcatccaggatgctatcctcttccccgatctgatccacgccgtcaagcccagaggtgac
aacgagatccctcaggctgccactgctcatgactcggcctgggacttcttcagccagcag
ccaagcacgatgcacacactgctctgggctatgtctgggcatggcattcctcgttctttc
cgacatgttgatgggttcggtgtgcataccttccgattcgtgacagatgacggtgcatcc
aagctcgtcaaatttcactggaagtctttgcagggcaaggccagcatggtctgggaagag
gcccagcagacctctggcaagaatcctgacttcatgcgtcaggatttgcacgatgcaatc
gaggctggacgctatccggagtgggaactcggtgttcaaatcatggatgaggaggaccaa
ctgcggttcggttttgacctcttggaccccacaaagatcgtgccagaggaattcgtgccc
atcaccaagttgggcaagatgcaactgaaccgcaaccctcgcaactatttcgctgagacc
gaacaagttatgttccaacctggtcacattgtccgtggtgttgacttcactgaagaccct
ctcctgcaaggccgtctgttttcgtacctggacactcagctgaaccgtcacggtggcccc
aactttgaacaactccccatcaaccaacctcgcgttcccgtgcacaacaacaaccgcgat
ggagcaggccaaatgttcattcccctcaaccctcacgcgtactcgcccaagacctccgtc
aacggttccccaaaacaagccaaccagaccgtcggcgatggcttcttcacagctcctgga
cgtaccaccagtggcaagcttgtccgtgcggtcagctcaagctttgaggatgtctggtct
cagccacggctcttctacaattctttggttcctgccgagaagcagttcgttattgacgcc
atccgcttcgaaaatgcaaacgttaaatctcccgtggtgaagaacaacgtcatcattcag
ttgaaccgcatcgataacgaccttgcacgacgcgttgcgcgcgctattggtgtcgccgag
cctgagcccgacccgaccttctatcacaacaacaagactgccgatgtcggcacttttgga
accaagctgaagaagcttgatggcctcaaggtcggcgtcctgggttctgtccagcacccg
ggctcggttgagggagcttccaccctccgcgaccgtctgaaggacgacggtgtcgacgtg
gttcttgtcgcagagcgtctggccgacggtgttgaccagacctattctacttcagatgca
atccaatttgacgctgtggtcgttgccgccggtgcagagagtctcttcgcggcatcctcg
tttaccggtgggtccgccaactcagctagtggtgcaagctctctgtaccccaccggtcgg
cccctgcagattctcattgacggattccggttcggcaagactgttggggcgctgggaagc
ggcacagctgctctccgcaacgcggggattgcaacgtctcgggacggcgtgtatgtggct
cagtcagtcactgatgactttgccaatgatcttaaggagggccttagaacttttaagttt
ttggaccggtttcccgtggatcactag

DBGET integrated database retrieval system