KEGG   Aspergillus fumigatus: AFUA_3G02830
Entry
AFUA_3G02830      CDS       T01017                                 

Definition
(RefSeq) ankyrin repeat protein
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5 Nitro_FeMo-Co
Other DBs
NCBI-GeneID: 3506079
NCBI-ProteinID: XP_748605
UniProt: Q4WFB0
Position
3
AA seq 628 aa
MTEEKAVPGKLEVALFLAASKGYDTIVKLLLSTPGVRLDFKDEDGRNAVSLAAEGGHESV
LQILLETGQVDVNAVDTKTGQSPLCWAVKNGHAGVVSKLLAVENIDPNIPDANGETPLYA
AVKSENGGIIDQLLARADLNANTPDAAGQTPLYWAVKNGNEAVAGALLGRAEVDPNAAGA
DGQTPLYLAVRNGHEGIMNRLLARGETNPDIPDANGQTPLYWAVEQGNLPFVVQLLKVNA
DPDVKDNQGRTPLLWAAEKGHEEVVRLLIGSRRVNVNAADAVGRTPLWWAARNGHLPVVR
LLVRNGADREAQPSPDDEKVAHGTPLYQAGRKYHTDIVKYLIKKGADIDCPCGESGLPLL
LALVVHDRTKRGMKMLNVLLEKGANVNARDTKGRTTLHILAKDGDMDLTALFLQRGAQVN
AAAKDGKTPLHLAVIHEHEEIVEMLLANGGDPEAADHTGDTPLHLAVFAGHRRLVGLLLE
KDCDINVTNHCGETPLHKAVERGHRKMVEFLLRNGAELEMQDDYKRTPLHRAVKAKNHVM
RLLVNKGANIHATDMYGQTALHIAAEAGLRDDVDFLLGHGAEAEAKDHKGRIPLDLAVKA
GEVEVEELLQEMSLVVVDASSGSEESGG
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgacggaagaaaaggccgtaccagggaagctggaagtcgcgctcttcctcgccgcaagc
aaaggctacgatacgatcgtcaaactcctcctgagcacccccggggtgcgtctcgacttc
aaagacgaggacgggcggaatgcggtctccctcgccgcagagggtggacatgagagtgtc
ctgcagatcttgctcgagaccgggcaagtagatgtgaatgcggtggatactaaaacaggc
caatccccgttatgttgggcagtgaaaaacggacatgcaggcgtggtgagcaaattactc
gctgttgagaatatcgacccgaatattcccgacgccaacggcgagacgcccttgtacgcg
gctgtgaagagtgagaatggggggataatcgaccaactactcgcacgggcggatctcaat
gcaaacaccccggacgctgctggacagacacccctctactgggctgtgaagaacggaaac
gaagcggtggcgggggcattactcggacgcgcggaggtggacccgaacgccgctggtgcc
gatggacaaacgccgttgtatttggctgtcaggaatgggcacgaagggatcatgaatcgt
ctgctcgcgcgcggtgagaccaacccggatatccccgacgcgaatggccagactcccctc
tactgggctgtggaacagggaaacctgccgtttgtggtgcagctgctcaaggtgaatgcc
gacccggatgtcaaggataatcagggacggacgccgttgctatgggctgcggagaaggga
cacgaggaggtggttcgattgctgatcgggtcgaggagagttaatgtgaatgctgccgat
gcggtcggcaggacgccgttgtggtgggctgcgagaaacggtcacctccctgtggtccga
ctgctcgtgcgcaacggggcggatcgagaagcgcagccgtctcctgatgacgaaaaggtc
gctcatggcacgccgctgtaccaggccggcaggaagtaccataccgacatagtgaaatac
ttgatcaagaagggcgctgacatcgattgcccatgtggagagtccggcctcccgcttctg
ttggcgctggtggtacacgatcgcacgaagcgcgggatgaaaatgctcaatgtgctactt
gagaaaggcgccaatgtcaacgcgagggataccaaaggaaggactacgcttcacatatta
gcaaaggatggcgacatggatctgactgccctgttcctgcagagaggcgcccaggtcaat
gctgccgccaaggacgggaaaacaccactgcatctggccgtgattcatgaacatgaggag
atagtcgagatgctcctggccaacggcggagaccctgaagcagccgatcacacaggagat
acaccccttcatctcgccgtgttcgcaggccatagacgactagtcggcttgctactagag
aaagactgcgatatcaacgtgacgaaccactgtggagaaacaccactgcacaaggcagtg
gaacgcggccatcgcaagatggtggagtttcttttgaggaacggggcggaactcgaaatg
caggacgactataagaggaccccgctgcatcgagcagtcaaggcgaagaaccacgtaatg
aggttgttggtcaataaaggagccaacatccacgcgacagatatgtacggtcagaccgca
ttacacatcgccgccgaggcgggactacgcgacgacgtggactttctactgggccacggc
gctgaagctgaagcgaaagatcacaagggtcggataccattagatctggcagttaaggct
ggcgaggtcgaggtcgaggagctcctccaggaaatgagtctcgtcgtcgtcgacgcatcg
tcaggaagcgaagagtcggggggctga

DBGET integrated database retrieval system