KEGG   Aspergillus fumigatus: AFUA_3G03970
Entry
AFUA_3G03970      CDS       T01017                                 

Name
(RefSeq) cytochrome b5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
afm  Aspergillus fumigatus
Pathway
afm00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_3G03970
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AFUA_3G03970
SSDB
Motif
Pfam: NAD_binding_1 FAD_binding_6 Cyt-b5 NAD_binding_6 FAD_binding_9
Other DBs
NCBI-GeneID: 3505938
NCBI-ProteinID: XP_748717
UniProt: Q4WEZ8
Position
3:complement(1131975..1133479)
AA seq 479 aa
MTVSTMADVSGAQKSPAVALPEYTLKEVALHNRKDDNWIVIHGQVYDVTKYQKDHPGGAD
VLAEVAGSDATEAFEDIGHSEDSREILEEFLIGTLQGAKEYVAPKKVRIIAQSPVETPAS
SSATRYVGAVTSLLGAVASLIYVYRRGSLYALDTTGSLHRYLSQPLRGVRLPQGGFANGF
LAATLICAAAGGVIARKAAKLTKIESGFLQYPPHIKARKVPRADPHLLKGFLDSKEFQRL
PLIQKDQLSSNVYRFVFGLPDSNGVIGLPIGQHVAIRAVIDGVTVSRSYTPVSNNLDRGR
LELVVKCYPDGVLSGKYLANLQVGDEVEFRGPKGAMRYKPGFCKKMGMVAGGTGITPMYQ
LIRAICEDERDTTEISLIYANRTEADILLRDELEQFARKYPKNFKLWYMLDTAPENWAYG
SGFVNQEVLSERLFAPSPDTKVLLCGPPGMVSATKKMLAAIGFQKPGPVSKMTDQIFCF
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgactgtttcaaccatggcagatgtcagcggtgctcagaaaagccctgctgttgcttta
cccgagtacacgctgaaggaagttgcgctgcataaccgcaaagacgacaattggattgtg
atccacggacaagtgtacgatgtgacaaaataccagaaagaccatcctggcggcgcagat
gttctggcggaagttgccggctcagatgcgacagaagcatttgaagacatcggccattca
gaagattcgcgcgaaattctcgaggaattcctgatcggaacccttcagggcgcgaaagaa
tatgtcgctccgaagaaagttcgcatcattgctcagagccccgtcgagactcctgcttct
tcatcagcaacccgatacgtaggagcggtcaccagtctgctgggagcagtcgcctccttg
atctatgtctaccgtcgcggttccctgtacgcacttgacaccacggggtcactccacaga
tatctgtctcagcccttaaggggggtaaggttgccgcaggggggcttcgccaatggattt
ctcgcagctactctgatttgtgcggcagcaggtggtgtgatcgcacgtaaagccgccaaa
ctaaccaagatcgagtcgggattcctgcagtatccaccgcatatcaaggcacgtaaggtg
cccagggctgacccgcacttgcttaaagggttccttgattcaaaggagtttcagcgcctg
ccgctcatccagaaggatcagttatcttcaaacgtataccgcttcgtgttcgggttaccg
gatagcaatggagtgattggtctacccatcggtcagcacgtcgccattcgcgctgttatc
gatggtgtcaccgtgagccggtcgtatacacccgtttccaacaacctagaccgaggaagg
ctggaattagtcgtgaaatgctatccggatggcgtgctctctggaaaatacctagcgaac
ctgcaagtgggtgacgaggtcgaattcagaggacccaaaggcgcgatgcgctacaaacca
gggttctgcaagaagatgggaatggtagccggcggaacaggaatcacacctatgtaccag
ctgatccgtgctatctgcgaagatgagcgtgatacgacggagatcagccttatctacgcc
aacagaactgaggcagacatcttactgcgggatgaactcgagcagtttgcccgcaaatac
cccaagaatttcaagctgtggtacatgcttgacacggccccggagaattgggcgtatgga
agcggcttcgtcaaccaggaggtcctcagcgagcgactattcgcgccttcgcctgacact
aaggtcctcctctgcgggcctccgggcatggtgagcgctaccaagaagatgctggctgcg
attggattccagaagccagggccagtttcgaagatgaccgaccagattttctgcttctaa

DBGET integrated database retrieval system