KEGG   Aspergillus fumigatus: AFUA_3G04170
Entry
AFUA_3G04170      CDS       T01017                                 

Definition
(RefSeq) pyruvate dehydrogenase E1 beta subunit PdbA
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm00010  Glycolysis / Gluconeogenesis
afm00020  Citrate cycle (TCA cycle)
afm00620  Pyruvate metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01200  Carbon metabolism
Module
afm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_3G04170
   00020 Citrate cycle (TCA cycle)
    AFUA_3G04170
   00620 Pyruvate metabolism
    AFUA_3G04170
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     AFUA_3G04170
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-GeneID: 3505976
NCBI-ProteinID: XP_748734
UniProt: Q4WEY1
Position
3
AA seq 377 aa
MAAPRLFRPAARLLSSRLSATPFRSTFQKSACAPSILRARGYATESGTKEVTVRDALNEA
LAEELESNPKTFILGEEVAQYNGAYKVTKGLLDRFGPKRVIDTPITEAGFCGLAVGAALA
GLHPICEFMTFNFAMQAIDQIINSAAKTHYMSGGIQPCNITFRGPNGFAAGVAAQHSQDY
SAWYGSIPGLKVVAPWSAEDAKGLMKAAIRDPNPVVVLENELLYGQAFPMSEAAQKDDFV
LPLGKAKIERPGKDLTIVSLSRCVGQSLNAATELKQKYGVEAEVINLRSVKPLDVETIIQ
SLKKTGRLMCVESGFPMFGVGSEILALSMEYGFDYLTAPAVRVTGAEVPTPYAVGLEQMS
FPQEDTIVGQAAKLLRL
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggctgccccccgacttttccgcccagcagctcgcctgctttcatctcgactttccgct
acacccttccgctctactttccagaagtccgcctgtgcgccatcgatcctacgcgctcgg
ggatatgcgacggaaagcggtactaaggaagttactgtccgagacgcattgaatgaagcc
cttgcggaggagcttgagagcaacccaaagacgtttatcctgggtgaagaggttgcgcag
tacaatggagcatacaaagtgacgaaaggtctattggaccgcttcggtcctaagagggtt
attgatactcccatcacagaggcgggcttttgtggtttggctgttggcgccgccctcgct
ggactgcaccctatctgcgagtttatgaccttcaacttcgctatgcaggccatcgatcag
attataaactccgccgccaagacacattacatgtctggaggaattcagccttgcaacatt
actttccgtggacccaacggatttgctgctggtgtcgccgctcagcactcccaagattac
tcggcctggtacggcagcattcctggcttgaaggtcgtggctccttggagtgctgaggac
gccaagggtctgatgaaggccgctatccgcgaccccaaccctgtcgttgtcctcgaaaac
gagcttctgtatggtcaagcattccccatgagcgaggctgctcagaaggatgacttcgtt
cttccccttggaaaggccaagatcgagcgtcctggaaaggatctgaccattgtttctctg
tcccgctgcgttggacagtctctcaacgctgctactgagctgaagcagaaatatggagtc
gaagctgaagttattaatcttcggtccgtcaagccactcgatgttgagacgatcattcag
tcgctcaagaagaccggtcgcctgatgtgcgtcgaatccggctttcccatgttcggtgtc
gggtcagaaatcctcgccttgtccatggagtatggtttcgactatctcactgctcctgct
gttcgtgttaccggcgctgaggttcctacaccttacgctgttggtcttgagcagatgagc
ttccctcaagaggatactatcgttggccaggctgccaagcttctacgactgtga

DBGET integrated database retrieval system