KEGG   Aspergillus fumigatus: AFUA_3G05370Help
Entry
AFUA_3G05370      CDS       T01017                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
afm  Aspergillus fumigatus
Pathway
afm00020  Citrate cycle (TCA cycle)
afm00310  Lysine degradation
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
afm01200  Carbon metabolism
Module
afm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFUA_3G05370
  Amino acid metabolism
   00310 Lysine degradation
    AFUA_3G05370
Enzymes [BR:afm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AFUA_3G05370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H
Motif
Other DBs
NCBI-GeneID: 3512665
NCBI-ProteinID: XP_755064
UniProt: Q4WWC7
Position
3
AA seq 445 aa AA seqDB search
MLRSWGKEVRAHYAALADRRHSIEPIYPGAVSPASAAIRSEITVSQFALDSMTLFADLAA
ADTIVKVPQMAESITEGTLKQFSKQVGDYVERDEEIATIETDKIDVSVNAPESGTIKELL
VNEEDTVTVGQDLVKLELGGAPGPKEETATEKPKEPADVGKRPPVESNKPQPSEAPKASS
PPPEQPPTAKPQPPAPKSDSPSDVKPSFEGREERRVKMNRMRLRIAERLKQSQNTAASLT
TFNEVDMSSLMEFRKLYKDDVLKKTGVKLGFMSAFSRACVLAMKDVPAVNASIEGPNGGD
TIVYRDYVDISVAVATEKGLVTPVVRNAETMDLVGIEKAIADLGKKARDNKLTIEDMAGG
TFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKDRPTVVNGKVEIRPMMYLALTYDHRLL
DGREAVTFLVKVKEYIEDPRRMLLG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgctccgttcttggggtaaggaggttcgcgcacattatgctgctctggctgaccgtcga
cattccatagagccaatttaccccggggcagtctcgcccgcctcggcggctatcagatca
gaaattacggtatcgcaatttgctttagattcaatgacgttgttcgctgatctcgccgca
gctgataccatagtgaaggtccctcagatggcggaatcgatcaccgagggtacattgaag
caattctcgaagcaggtgggcgattacgttgagcgggacgaagaaatcgctacaattgag
accgacaagatcgacgtctcggtcaatgcgcccgagtctgggactataaaggagctcctc
gtgaacgaagaagacactgtgacggttggccaggacttggtcaaactcgaattaggtggt
gctcctgggccaaaagaggagacagctactgagaagccaaaggagcccgcagatgtcggg
aagcggcctcctgttgaatccaacaagccacaaccgtcagaggcccccaaagcttcatcg
cctccgcctgaacagcctcctactgccaagcctcagccccctgctcctaagtcagactct
ccttctgacgttaaacctagctttgaaggtcgtgaggaacgcagggtgaaaatgaataga
atgagactgagaatagccgagcgcctgaagcagtcccaaaacaccgcagcctcgctcact
accttcaacgaagttgacatgtcatccctcatggaatttcgaaaactctacaaagatgat
gtgctgaagaaaaccggtgtcaagcttggcttcatgagcgctttctctcgtgcctgtgtc
ctagctatgaaggacgtccccgccgttaatgcatcaatcgaaggccccaatggtggtgat
accattgtttaccgcgactacgttgacatcagcgtggccgttgctactgagaagggtctt
gtgacacctgtcgtccgtaacgctgaaacaatggacctcgtcggaattgaaaaggccata
gcagaccttggcaagaaggcacgggacaacaagttgacaatcgaggatatggctggtggc
acgttcaccattagcaacggtggtgttttcggctctttgatgggcactccgatcatcaac
ttgccccagactgctgttcttggactccatgcaatcaaggaccggccaacagtcgtgaac
gggaaagtggaaattcgtccaatgatgtaccttgccctaacctatgatcaccgacttttg
gatggacgggaggcagtcactttccttgtcaaggtcaaggaatacattgaagatcctcgt
cggatgttgcttggctag

DBGET integrated database retrieval system