KEGG   Aspergillus fumigatus: AFUA_3G13150
Entry
AFUA_3G13150      CDS       T01017                                 

Definition
(RefSeq) deacetylase complex subunit Sds3
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: Sds3 CcdA
Other DBs
NCBI-GeneID: 3511899
NCBI-ProteinID: XP_754307
UniProt: Q4WYI4
Position
3
AA seq 506 aa
MAYSPAPASPATGTAGQTLSSSLHPRGRSPSPATNAPLSKRDKRRGALQERLHDLTATFS
HNRDAQFRQQLHTLQCDMTLINNADPYSPGPLPDSAEEIAALVEKTIGGGAFAKEMANLS
GMWYSRFVQEVNQAKEERDAELAALVHRHNNNLERFQREYAFRVHFAGEEYNNLSSTLRE
RLVQTISGKKARLMREKEQLDIADTNALLLHPNQFSITNPASPGGVHGNRKTRHTRHRVD
LDELGNGIVSEFNKRKRKAPEEDTGSPVRDPNPAERAKSQLAEKQHAPTYSIHTLFTEKE
LSAHANQAHVATVHFFSTSKRADQPSGTTTNGNNTDVEESGTGDGTGQEDNGTPAADMVR
TASQNYHATRSTRTHGNHALNALAELSDKPAVRPNLPYNVLANYHARPNSNAPPLPSLMN
EEVEDDCARLDRLHNKSAGWVDRNLIELLVERVPAEVDGTPQNPHRFSLLHPDFPTDMGV
HLYPLKTNGRDVELQSYERTKKARAS
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggcttactctccggcaccggcatcgccagctactggcacagctggacaaaccctgagc
agcagccttcaccctagaggccgatctccaagccccgcgacgaacgcgcccctctcgaaa
cgggacaagcgccgcggagcactacaagaacggctgcacgatctcacggcgaccttcagc
cataaccgagacgcgcaatttcgccagcagctgcatacattgcagtgcgatatgacattg
atcaacaatgcggatccgtactccccgggtccgctgcccgactcggcggaggaaatcgcg
gctttggttgagaagacgatcggtgggggagcttttgcgaaggagatggctaatttgtct
ggcatgtggtattcaaggtttgtgcaggaggtgaatcaggctaaggaggagagggatgcc
gagttggcggcacttgtgcaccgtcataacaacaatctagaaaggttccaacgggaatac
gccttccgggtgcacttcgccggtgaagaatacaacaacctctcctcgaccctgcgcgaa
cggctggtacagacaatctcagggaagaaggcccggttgatgcgggaaaaggagcagctc
gatattgctgataccaatgctctcctccttcatcccaatcaattcagcattaccaaccct
gccagtcctggtggtgttcacggcaatcgtaaaacccggcatacccgccaccgagtcgac
ctagacgaattgggcaacgggattgtgtcagagttcaataaaaggaagaggaaagcgcct
gaggaggatactggctctccggtgcgggatccgaacccggccgagcgggccaagtcccag
ttggccgagaaacagcacgcgccgacatattctatccatactctgttcacggaaaaggaa
ctcagcgcacatgccaatcaagcccacgtcgccacggtgcatttcttctcgacatccaaa
cgggctgatcagccttcaggcactacgacgaacgggaataacactgatgtcgaagagtca
ggcacgggtgacggtaccgggcaggaagataatggcacaccagccgccgacatggtgcgc
accgccagccagaattaccatgcgacacgctccacacggacgcacggcaatcatgcgctc
aatgcgctggccgagctgtcagacaagcccgcggtccgcccgaacctgccatataatgtt
ctcgccaattaccacgcgagaccgaacagtaatgcgccaccgctgccgtctctgatgaac
gaagaggtagaagacgattgtgctcggttagaccgcttgcacaacaagtctgcgggttgg
gttgaccgtaacctgatcgaactgcttgtggagcgggtcccggccgaggtggatgggacc
ccgcagaatccgcaccggtttagtctgttgcaccccgactttcctaccgatatgggggtg
catctctacccgctcaagactaatggcagagatgtggagctccagagctacgagcgcacc
aagaaggccagagcgagctag

DBGET integrated database retrieval system