KEGG   Aspergillus fumigatus: AFUA_3G13240Help
Entry
AFUA_3G13240      CDS       T01017                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
afm  Aspergillus fumigatus
Pathway
afm00010  Glycolysis / Gluconeogenesis
afm00052  Galactose metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
Module
afm_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_3G13240
   00052 Galactose metabolism
    AFUA_3G13240
Enzymes [BR:afm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AFUA_3G13240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 3511773
NCBI-ProteinID: XP_754298
UniProt: Q4WYJ3
Position
3
AA seq 460 aa AA seqDB search
MNTSPVFNRRTPPLCDCFRSLLCPARITPRVLIIYCSFFITITILLGLRMHVKHYLSAVL
YGLPVLAQSTQSSSSSSSSTSATDPFKVYTISAENITAKLIPYGARLISLMVPDRDGKEQ
DVVIGYDDPKAYLNDTETVHTFFGAVVGRYANRIKNGTFTIRSNEYHVPKNENNGIDTLH
GGKVGYDQRNWTVTAHSKSSVTFTLYDQGWEDFPGDVITHAVYSVDTAVTPQNPKGLPQL
TTKLISLALTEATPIMLSNHIYWNLNAFKAPNVLNDTFLQLPYSNRLIATDGILIPNGTI
LTVDAFNGAPDFTEGKLIGADLKDTYGMCGTDCTGYDTCWLVDRPPQYAAPDSLVPIVRM
NSSATGISLEVSSNMPALQIYTCDNAKMDYLPIKPSQEKRNKEEGKEGAKNVMQYGCVVI
EPEGWIDGINHPEWGQLPLQIFSPNDGPAVNWATYQFGTV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttctccagtatttaaccgacgcacaccccctctttgtgactgctttcgttct
ttgctgtgtcctgctcggataacgcctcgtgtcttgatcatttactgctcctttttcatc
actatcactattctcctggggctcaggatgcatgtcaagcactatctctcggccgtcctt
tatggactgccagttttggctcagagtacacagtcgagctcctcttcttcgtccagcact
tcagctacagatcccttcaaggtctacaccatcagcgcggagaacatcactgccaagctg
attccctatggagctcgactgatatctctgatggtcccggatcgcgatggcaaggagcag
gatgttgtcattggctatgatgaccctaaggcctacctgaatgatacagagacagtccac
accttcttcggtgctgttgtgggtcggtacgccaatcgcatcaagaacggcacgttcacc
atccgcagtaatgagtaccatgtcccgaagaatgagaacaacggcatcgacactctccac
ggaggcaaggtaggctacgaccaacggaactggactgtgacagcacattccaagtcttcc
gtcaccttcactctctacgatcaaggttgggaagactttcctggagacgtcatcacccac
gccgtctacagtgtcgacacggctgtcactccacaaaacccaaagggtctcccccagctg
accaccaaactgatctcccttgccctgacggaggcgactccaattatgctctccaaccac
atctactggaatctcaatgccttcaaggcccctaatgtcctaaatgacaccttcctgcaa
ctcccttactccaaccgcctcatcgccacagatggcatcctcatccccaatggcaccatc
ctcacggtcgacgcgttcaacggcgcccccgatttcaccgagggcaagctcatcggcgcc
gatctcaaggatacctacggcatgtgcggcaccgactgcaccggctacgatacctgctgg
ctcgtcgaccgaccccctcaatacgctgctccggactcgctcgtccctatcgttcgcatg
aactccagcgcaaccggtatcagccttgaagtatcgtccaacatgccagcgcttcaaata
tacacctgcgacaacgccaagatggactacctccccatcaagccgtctcaggagaagcgt
aacaaggaagagggcaaggaaggcgcaaagaatgtcatgcaatatggctgcgtggtcatc
gagcccgagggctggattgatggcatcaaccaccctgaatgggggcaattgccactgcag
atcttctctcccaacgatggtccagctgtcaactgggctacttatcaattcggcactgtc
tag

DBGET integrated database retrieval system