KEGG   Aspergillus fumigatus: AFUA_3G13460
Entry
AFUA_3G13460      CDS       T01017                                 

Definition
(RefSeq) F-box domain protein
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: F-box-like F-box PRANC
Other DBs
NCBI-GeneID: 5077060
NCBI-ProteinID: XP_001481628
UniProt: A4D9D1
Position
3
AA seq 422 aa
MSAILEQLRQHAKKAGAAIHRSRKSEAKKPYRKSLFSSSFSSSSVIEKTDIVSTSSPWDL
LPVEIQIKIFSQCGIKDLLQLKLVCKAFCQVLTFHEQLIARQYLRQARHGTLPSPIDSER
EYTRNPEDDVVLLSDLFPPAKSAKGGHLYTFRYIHSLRRRAKLCSKLCYYLADRVMDRFV
HCEPAFVKAMFPSRHERNEFLERGKSSLWFNLIPLMYYTLYFLESYSLARRELKNALLQD
MEAGRLPLPISPDVRKSMYRDLQIAILRSAPFTNTSTLICTHHCMQLLVSYLRHTVPPEE
PVADDSWIGSLLTASPFLRIVEYFSAEIGDGGSQRVQRKDFMRNFHNDLMLNEKDDINSL
VFQSTPVSHLHSSVQDVWFDVAREELASRRACPHDAENIRVWKGVTVALGCQDCRQGRAW
RA
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagtgcgatcctggaacaactgcgacaacatgcaaagaaagccggtgctgccattcac
agaagcagaaaatcagaggctaaaaagccatatcggaaaagtctcttttcgtcctcattc
tcatcaagctcggttatcgagaaaaccgacatagtatcaacttcctcgccctgggatctc
ctgcccgtcgagatccaaatcaagatattctctcaatgtggtattaaagacctgctgcag
cttaaactcgtttgcaaggccttttgtcaagtcctcacatttcatgaacagctgatcgca
cgccaataccttcgacaggcccgccacggaacgctaccatctcccatcgacagcgagaga
gagtatactcgaaatcccgaagacgatgtagtgcttctgtccgaccttttccctcctgcc
aaaagtgccaagggcggtcatttatacacttttcgctatatacatagcttgcgacggcgg
gcaaagctgtgttccaagctttgctactacctcgcagaccgcgtcatggatcgattcgtc
cactgcgagccagcttttgttaaggcgatgtttccatccagacatgagcgcaatgagttc
ctggaacgggggaagtccagtctatggttcaacctcataccacttatgtactacacgcta
tacttcttggagtcttacagtcttgcccgtcgtgaattaaaaaatgcacttttgcaagat
atggaagccggacgattgcctcttcctatatccccagatgtccgtaaatcgatgtaccga
gatttgcagatcgcaatccttcgatcggccccattcaccaatacttcgactctgatctgt
acgcaccattgtatgcagctgctcgtttcgtacctacgacacactgtgccacccgaggag
cccgtggcggatgacagctggatcggctcactgcttactgcatcaccgtttcttcgaata
gtggaatacttctccgcagagataggtgacggtggcagtcagagagtgcaacgaaaggat
ttcatgcgtaacttccataacgatttgatgctgaatgagaaagacgatatcaactcgttg
gtgttccagagcacaccggtgtcgcatctacattcatcggtgcaggatgtttggttcgat
gttgctagagaggaattggcctcacggagagcttgtccacatgacgcagagaatatccgg
gtctggaaaggggttaccgtggcattaggttgtcaagattgtcgccaaggcagggcctgg
cgtgcctga

DBGET integrated database retrieval system