KEGG   Aspergillus fumigatus: AFUA_4G04520Help
Entry
AFUA_4G04520      CDS       T01017                                 

Definition
(RefSeq) succinyl-CoA synthetase beta subunit
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
afm  Aspergillus fumigatus
Pathway
afm00020  Citrate cycle (TCA cycle)
afm00640  Propanoate metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
afm01200  Carbon metabolism
Module
afm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFUA_4G04520
   00640 Propanoate metabolism
    AFUA_4G04520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afm04147]
    AFUA_4G04520
Enzymes [BR:afm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     AFUA_4G04520
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AFUA_4G04520
Exosome [BR:afm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFUA_4G04520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A VID27_N
Motif
Other DBs
NCBI-GeneID: 3503973
NCBI-ProteinID: XP_746638
UniProt: Q4W9L3
Position
4
AA seq 444 aa AA seqDB search
MFKLARSSRPVAAAIRAATESSVQFRLAQQQRNLSIHEYLSARLLKSYGVGVPKGEVAHS
AEEAEAVAKSIGNDDMVIKAQVLAGGRGKGSFDNGLKGGVRVIYSPTEAKMFASQMIGHK
LITKQTGAAGRLCNAVYICERKFARREFYLAVLMDRATQTPVIVASSQGGMDIEAVAKEH
PEAIMTTPIDIKVGVTDDIARKIATDLGFSEQCIEDAKTTIQNLYKVFMEKDATQIEINP
LSETSDHQVLAMDAKLNFDDNAEFRQKEVFSWRDTTQEDADEVKAAEYGLNFIKLDGDIG
CLVNGAGLAMATMDIIKLNGGNPANFLDVGGGATPAAIKSAFELITSDPKVTAIFVNIFG
GIVRCDAIARGLINVVEDMGLRIPIVARLQGTNMEQAQKLINESGLKIFSIEDLQSAAEK
SVQFSKVVKMAREIDVGVEFTLGI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagctcgcgcgaagcagccgtcctgtcgctgcagctatcagagctgcgacggaa
tcctccgtccaattcagactggcccagcaacagagaaacctgtccattcacgaatacctc
tctgccagactgctcaaatcctatggcgtcggagttcccaagggtgaggtcgcccactcg
gcagaggaagcagaggctgtcgctaagtcaatcgggaacgatgacatggtgatcaaggct
caagttcttgctggtggccgtggtaagggttccttcgacaatggtcttaagggaggtgtg
cgcgttatctactccccaaccgaggccaagatgttcgctagccagatgatcggacacaag
ctcatcaccaagcagactggtgctgctggtcgcctttgcaacgctgtctacatttgcgag
cgcaagttcgctcgtcgtgaattctatcttgccgtcctcatggaccgcgcaactcagacc
cccgtcattgttgcctcgtcgcaaggcggtatggatattgaggcagttgccaaggaacac
cctgaggctatcatgacgactcctattgacatcaaggttggcgtgactgatgacattgcc
cgcaagattgctaccgatcttggcttctctgagcagtgcatcgaggatgccaagacaacc
atccagaacctgtacaaggtcttcatggagaaggacgctactcagattgagattaaccct
ctgtctgagacctccgaccaccaggttctggctatggacgccaagctgaactttgatgac
aacgctgagttcagacagaaggaagtcttctcgtggagagacactactcaggaagacgcc
gatgaggtcaaggctgctgagtacggcttgaacttcatcaagctggatggtgacattgga
tgcctggtcaacggtgctggtctcgccatggccaccatggatatcatcaagctcaacggc
ggaaaccccgccaacttcctcgacgttggtggtggtgctacccccgccgctatcaagtct
gcttttgagctcatcaccagcgacccaaaagtcactgccatcttcgttaacattttcggc
ggtatcgtccgctgcgatgctatcgcccggggtttgatcaatgtcgtggaggatatgggt
ctgcgcatccccatcgttgctcggttgcagggtaccaacatggagcaggctcagaagctg
atcaacgagtccggtcttaagatcttctccatcgaggacctccagagcgccgccgagaag
tccgtccagttctccaaggtcgtcaagatggcccgtgagattgacgtcggtgtcgagttc
accctcggtatctaa

DBGET integrated database retrieval system