KEGG   Aspergillus fumigatus: AFUA_4G06070
Entry
AFUA_4G06070      CDS       T01017                                 

Definition
(RefSeq) translation initiation regulator (Gcn20)
  KO
K06158  ATP-binding cassette, subfamily F, member 3
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:afm03012]
    AFUA_4G06070
Translation factors [BR:afm03012]
 Eukaryotic type
  Initiation factors
   Initiation associated factors
    AFUA_4G06070
SSDB
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N AAA_22 MMR_HSR1 AAA_16 RsgA_GTPase AAA_29 AAA_23 AAA_30 AAA_18 Dynamin_N AAA_28 AAA_24 AAA_15 NACHT ATP-synt_ab DO-GTPase2
Other DBs
NCBI-GeneID: 3509653
NCBI-ProteinID: XP_752217
UniProt: Q4WNK5
Position
4
AA seq 751 aa
MEAELQAQIPGLDRVISEYSVGYLTHASNAYVEDANAPSPLSEAADMVTELLVSASGDFS
EHNEKAIRNLVEKFISSLSSSDGVDAERRQMPFTAKKLDQAIHVGSQRNMSSTLGLAGGN
VDLESANSRKVESRVDRKKLEKAERKIRAKQEKKQMKTVQYEASRLLNQPESTLSYEEFF
MAVNPLQLGSDSQSKSKDIKVDSIDISIGGHRILTDASLTLAYGRRYGLVGQNGIGKSTL
LRALSRREVAIPSHISILHVEQEITGDDTPAIQAVLDADVWRKRLLAEQEKISKQLAAIE
AERSSMADTSKDAARLDHEREGLDITLNDIHSKLAEMESDKAESRAASILAGLGFSPERQ
QYPTKTFSGGWRMRLALARALFCEPDLLLLDEPSNMLDVPSITFLSNYLQSYPSTILVVS
HDRAFLNEVATDIVHQHSERLDYYKGANFDSFYATKEERKKIAKREYEKQMAERAHLQAF
IDKFRYNAAKSSEAQSRIKKLERMPVLEPPESDYVVHFKFPDVEKLSPPIVQMSDVSFGY
SKDKLLLRNVELDVQLDSRIGIVGPNGAGKTTVLKLLTGQLQPTSGLISTHARLRIGYFA
QHHVDALDLTTSAVSFMAKTYPGKTDEEYRRHLGAFGITGTTGLQRMELLSGGQKSRVAF
ACLSLTNPHILVLDEPSNHLDIEGMDALSEALQRFEGGVVMVSHDVTMLRNVCTSLWVCD
KGTVHKFDGTVDAYKKMISSQANEAGVVAQH
NT seq 2256 nt   +upstreamnt  +downstreamnt
atggaggcggaactccaggcacaaattcctggcttggatcgtgtgatctcggagtattct
gtgggttatctgactcacgcctcaaatgcttatgtcgaggatgcaaatgctccgtcacca
ttatcggaagccgccgacatggtgacagagcttcttgtttccgcttctggagacttctcc
gaacacaatgaaaaggccattcggaacctagtcgaaaaattcatttcctccctgagttcg
tctgatggcgtcgatgcagagcgcaggcagatgccgttcaccgcaaagaagctggaccag
gccatccatgtcggctcccagaggaacatgtcctccacgctcggccttgctgggggtaat
gtcgatctcgagtccgccaactccagaaaggtagagtcccgagtggaccgcaagaagctc
gaaaaagcagaacgaaagattcgtgccaagcaggaaaagaagcagatgaaaacagtgcaa
tacgaagcatcccgtctcctcaaccagccagagagtactctgtcctatgaagagttcttc
atggctgtcaacccacttcagctgggatcggattcgcaatctaagagcaaagatatcaag
gtcgacagcattgacatttctatcggcggtcaccgcatcttaaccgacgcctcccttacc
ctagcttacggacgccgctatggtcttgtgggtcagaacggtatcggaaagtctactctc
ttgcgtgccctgagtcgccgagaggtagccattcccagccacatctcaattctacacgtc
gagcaagagattacgggcgatgataccccggcaattcaggctgttctcgacgcagacgtt
tggcggaaacgtcttcttgcagagcaagagaaaatcagtaaacaacttgcagcaattgaa
gcggaaaggtcgtctatggcagacacatcgaaagatgctgccaggcttgaccatgagaga
gagggtcttgatataactctgaatgatattcattccaagctggccgagatggaatccgac
aaggcagaatctcgcgctgccagtatcctagccggtctcggcttctcaccggagagacag
caatatcctacgaagacgttctctggtggttggcgaatgagactggccctcgcacgggct
ttgttctgcgagccggacttacttctgcttgacgaaccttcaaacatgttggacgtgcca
tccattaccttcctatccaactacctccagtcatatcccagcactatccttgtagtgtct
cacgatcgagcgttcctcaacgaggtggccacagatattgtgcaccagcattctgaaaga
ctagactactacaagggagccaactttgattcattctatgccaccaaggaggagcggaag
aagatagccaagcgcgaatatgaaaagcaaatggcggaacgcgcccatctgcaagccttc
attgacaaattccgctataatgccgccaagtcatccgaagcgcagtcgagaatcaagaaa
ctggagagaatgccagtcctggaacctccagagagtgactatgttgtccattttaagttt
ccagatgttgagaagctttcccctccgattgtacagatgtcggatgtctctttcggctat
agtaaagacaaactgctcctcagaaatgtggaactcgatgtccagctcgattcccgtatt
ggtattgttgggccaaacggcgctggtaagactacggtgctgaagctgttgactggtcaa
ctccagccaacatccggcttaatctcgacccatgcaaggttgcggatcggctacttcgcg
caacaccatgttgacgcgctggatcttactaccagtgcggtgagcttcatggccaaaacc
tatcccggaaagacagatgaagagtatagacggcatctgggagccttcggtatcaccgga
actaccggtcttcagcgcatggagttattgtctggaggtcaaaagtcccgtgtcgcattc
gcctgtctctccctgactaacccccacatccttgtgcttgacgaaccttctaatcacttg
gatattgagggtatggatgcgctttctgaagcgctgcagaggtttgaaggaggtgtggtg
atggtgtcacacgatgtgacgatgctgcggaatgtctgtaccagcctttgggtctgtgac
aagggtacggtacacaagtttgatggcactgtcgatgcctacaagaagatgatcagctct
caggccaatgaggctggtgtggtggcgcaacattag

DBGET integrated database retrieval system