KEGG   Aspergillus fumigatus: AFUA_4G08510
Entry
AFUA_4G08510      CDS       T01017                                 

Definition
(RefSeq) mRNA capping nucleoside-triphosphatase
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: mRNA_triPase
Other DBs
NCBI-GeneID: 3509234
NCBI-ProteinID: XP_751975
UniProt: Q4WP97
Position
4
AA seq 796 aa
MDLRTIMNSDATGTSDAAPAPSQQSLSRTESVYPPRQPQNVTASPSSSSSSHPPGSQQQP
PPLQRPHASPERSSSYGSIQSPFQYHSASALSAGAQSQRGQSPPPPAPPFASSGSRDSYS
ASASYNTAASLASPYTPQPASSTGPFPEQQQQQSYFAQQRSQSIQSVLSPPPATNHSFPP
RDSPSSAASQSHPSQLFSPPAHGSLPGTPRASATTSLPRQTTPSTRPQSSGHDSQSHHGS
SPWVGPDSQVHMSPTSMPRASRQDSRHRELTPRQFPPRVDRRASDESVSPKTAYPAASRQ
GSVTSTSEQRFAAQSSRVGDGETRENSAASIMNMSQSSVAPGDARTAPTTSRINSSPSSQ
SFKPNESLTGDAFPTKMDVPPDFRPDSSDRPAKRRRRRYIEPPIFAQRSVRTKGRCPMIP
NPLPPIPKHLRDSPQNPFEARRQSTPSQAPAATVAPSTAATAVTKSEPPPVNGPPAARLP
PTPAASALPVGSLGPWEPSITGFIPHEEITKLVCDFLFQHVVLRNDATAAPAGTAAAGQG
AIIEVEAKLGHIIDMDRGERLSLPILTESVINKENPRFRTAFESSMTLSQHRAMNNFLNE
AVKASMPQTNQGRIPLSYAHKKERDTFYEISPSELPPVIRQNLNPRHKPKVRVTVDQRTG
EVLAKIVKCRIADMDVHSPRTSVDWRVSVNLEMSYDGDVSHLPMVDSRGGRGGDRSKDRM
SYRHLAYQIDLTQVAKSEPPSKGDFEHELEIEASAAEIRRQGQLAMAGDPQNQYEDLVKG
FVDNIRVLARAVPPPS
NT seq 2391 nt   +upstreamnt  +downstreamnt
atggatttgcgcacgatcatgaatagcgatgccactggcacctctgatgctgcccctgct
ccgtcgcaacaatcgctttctcgaaccgaatccgtgtatcctccacgtcaaccgcaaaat
gtcaccgcatcgccctcgtcctcgtcgtcctcccatcctcctggatcccaacaacagccg
cctccattgcagaggcctcatgcgtctccagagcgatcgtcttcctatggctcaatacaa
tcgcccttccagtatcattcggcttctgcgctgagtgccggtgcgcaatcccaacgaggc
cagagtccgccccctccagctcctccatttgcttcctccggctcgcgtgactcctattct
gcgtccgccagttataacacggctgcatcgttggcctctccatacaccccgcaacccgcg
agttccacaggtcctttcccagagcagcaacagcagcagtcgtatttcgcgcagcagcga
tcccagtccatccagtctgtcctctcccctccacccgcgaccaaccactcattcccaccc
agagacagtccttcctcagctgcttcgcagtcgcatccgtcacaactgttctcaccccct
gcgcatgggtcgttgcctgggactccgcgagcatccgctaccacatcactaccgcgtcaa
acaacgccgtccacgcgtccccaatcctccggtcatgactcccaatcacaccatggctca
agcccttgggttggcccggattctcaagtccacatgtctccaacttcgatgccaagagct
tcgcgtcaggattcaagacaccgggagctgacccctcgacaatttcctccgagagttgac
aggcgagcatcagatgaaagcgtgagccccaagactgcctatcctgcagcatcccgacaa
ggaagcgtgacctcaacctccgagcagaggtttgcagcgcagagcagccgcgttggggac
ggcgaaacgagagagaactccgcagcgtctattatgaatatgtcgcaatcgtcggttgct
cctggggacgctcgtactgcgcctacaacatctcgaataaacagctcgccttcatcccag
tcgttcaagcccaacgaatccctcactggagacgcatttccgaccaagatggatgttcct
cctgatttcagacccgattcgagtgaccgtcctgcgaagcggagaagaagacgatatatt
gagcccccaatcttcgctcagcggtctgttcgcactaaaggacgatgcccgatgattcca
aacccactcccaccgattcccaaacatctcagagactcgccccagaatccattcgaagca
cgtcgacagtcaacaccttcacaagcgccagccgctacagtcgcgccttcgaccgccgcg
acagctgtgaccaagtcggaaccaccacctgtgaacggccctccagcggcccggttaccc
ccgaccccggccgcttcggctctcccagtaggaagcttaggtccatgggagccctcgatc
accgggttcatacctcacgaggaaattaccaagttggtgtgcgactttttgttccaacac
gtagtgctcaggaacgatgctactgctgcacccgccggcacagctgcggcgggtcagggg
gccatcatcgaggtggaagctaagttggggcacattattgacatggatcgtggcgagaga
ctcagcctcccaatcttgacagaaagcgtcattaacaaggaaaaccctcgttttcggacc
gcattcgaaagttcgatgacgctttcacaacatcgggcaatgaacaactttctcaacgaa
gctgtgaaagcatctatgccccaaacaaatcaaggtcgaattcccctgtcctacgctcac
aagaaagagcgagacaccttctatgaaatttccccatccgagcttccgccagtcatcaga
cagaacctcaatccccgtcacaaaccaaaggtccgcgtcacagtcgatcagcgcactggc
gaggtcctcgctaagatcgtcaaatgccgcattgcagacatggacgtgcacagtccgcgc
acaagcgtcgattggcgagtcagcgttaacctcgaaatgagctacgacggcgacgtcagt
caccttccaatggtagacagccgaggcggccgcggtggagacagaagcaaagaccgcatg
agctacagacatttggcgtaccagatcgaccttactcaggttgccaagtcagaaccccct
agcaaaggcgacttcgaacacgaactcgagatcgaggcctccgctgctgagatccgccgt
cagggccagctagccatggccggtgacccgcagaatcaatacgaagatttggtcaaagga
tttgtggataacatccgcgtgctggcgcgtgcggtgccgccgccttcttga

DBGET integrated database retrieval system