KEGG   Aspergillus fumigatus: AFUA_4G08580Help
Entry
AFUA_4G08580      CDS       T01017                                 

Definition
(RefSeq) mitochondrial peroxiredoxin Prx1
Organism
afm  Aspergillus fumigatus
SSDB OrthologParalogGFIT
Motif
Pfam: AhpC-TSA 1-cysPrx_C Redoxin
Motif
Other DBs
NCBI-GeneID: 3509217
NCBI-ProteinID: XP_751969
UniProt: Q4WPA3
Position
4
AA seq 213 aa AA seqDB search
MAQERAAPLRLGSTAPDFEADTSNGPISFHKFIGDSWAILFSHPDDFTPVCTTELGAFAK
LEPEFAARNVKLIGLSANGTDSHKAWIKDIDEVNGSKLTFPIIADPSRKIAHLYDMVDYQ
DTTNVDEKGIAFTIRSVFIIDPAKKIRLIMAYPASTGRNTAEVLRVVDALQTTDKHGVTC
PINWLPGDDVIIPPPVSTEDAKKKFGEIREVKP
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggaacgtgctgctcctctccgtctcggctctactgcccctgacttcgaagct
gatacctccaatggtcctatctccttccacaagttcattggcgacagctgggctatcctc
ttctcccaccctgatgacttcacgcccgtctgcaccaccgagctcggtgctttcgctaag
ctcgagcccgagttcgctgcccgcaatgtcaagctgattggtcttagcgccaatggcacc
gactcccacaaggcctggatcaaggacatcgacgaggtcaatggctccaagctcaccttc
cccatcattgccgaccccagccgcaagattgcccacctgtacgatatggttgactaccag
gacactaccaacgtcgacgagaagggcatcgctttcactatccgttccgttttcattatt
gaccctgccaagaagatccgtctgatcatggcctaccccgcctccactggccgtaacacc
gccgaggttctccgtgtggttgatgccctccagaccaccgacaagcacggcgttacctgc
cccatcaactggctccccggtgacgatgtcatcattccccctccagtctccactgaggat
gctaagaagaagtttggcgagatccgtgaggtcaagccgtaa

DBGET integrated database retrieval system