KEGG   Aspergillus fumigatus: AFUA_4G09080
Entry
AFUA_4G09080      CDS       T01017                                 

Definition
(RefSeq) C2H2 transcription factor (Seb1)
  KO
K21545  C2H2 transcription facotor
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:afm03000]
    AFUA_4G09080
Transcription factors [BR:afm03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    AFUA_4G09080
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-met zf-C2H2_6 zf-C2H2_jaz HAT_KAT11 zf-C2H2_3rep zf-BED
Other DBs
NCBI-GeneID: 3509523
NCBI-ProteinID: XP_751917
UniProt: Q4WPF5
Position
4
AA seq 618 aa
MDATYTMAQTPVQGQPSFAYYPTESQSRQQHFTSHPFEMQYYGQVSSYPQQQAQQQHSMP
EQQPVYAAQPMLNMHQMATTNAFRGALSMTPIASPQPTHLKPTIIVQQDSPALMPLDTRF
VSNDFYGFPSTPPLSTSGSTISSPPSSNGSLHTPINDCFFSFEKVEGVKEGCESDVHCEL
LANTDWSRSDSPPLTPVFIQPQSLTASQSSDLLSAQIPCPSLSPSPSPDSATFISHPQSI
LSAEPSGSDFCDPRQLTVESSVGAPAELPPLPTLSCNEEEPKVVLGSATVTLPVHEGLSP
SFSSSSEDPLGSLPTFDSFSDLDSEDEFANKLVDFHPIGNTYFQGDKRQRLGTYLLDEDE
FLSERSLEDLDDQEAFAQSGLPSVESTDFLAVEGDATQSTEEMSSKKRVTSRRSLKKAST
SESSSDSLAKKTQASATSRSGHSDTTSTVQQSTASSRQNSTANTSNSESPAAPVSVNRRG
RKQSLTDDPSKTFVCSLCSRRFRRQEHLKRHYRSLHTQDKPFECHECGKKFSRSDNLAQH
ARTHGGGSIVMGVIDTNSSNTQPAFDEPEPRALGLALYEAANAATSKSTTSESSDGTISD
TSSVGGRPAKKRRRDDHV
NT seq 1857 nt   +upstreamnt  +downstreamnt
atggacgcaacatacaccatggcacagaccccagtgcagggacagccatcatttgcatac
tacccaacagagtcgcaatcgcggcagcaacatttcaccagtcacccgttcgagatgcag
tactatggacaagtgtcgtcttacccacagcaacaagctcagcaacagcacagcatgcca
gaacaacagccagtctatgctgctcaacctatgttgaacatgcatcagatggccacaacc
aatgccttcaggggtgccctcagcatgaccccgattgcctccccacagccgacccatctc
aagcctaccatcatcgtacagcaggactccccagctctcatgcctctggacacgagattc
gtcagcaatgacttctatgggttcccttcgaccccaccgctgtctacatctggaagcacc
atcagcagccctccgtccagcaatggctctcttcataccccaatcaatgattgcttcttc
tcatttgagaaggtggaaggggtgaaggaaggttgcgagagcgatgtgcactgtgagctc
ctggccaacaccgactggtcgcggtctgactcgcctcctttgacacctgtgtttatccaa
ccacaatccctcaccgccagccagagctcagatctcctatcagctcaaatcccctgccca
tccctttctccatcaccctctccggactcggcaactttcatctctcatcctcagtcgatt
ctctcagctgagccctctggatccgacttctgcgaccctcgacagcttacagtcgaatcg
tcagttggagctcctgcagagttaccgccattgcctactctttcctgcaatgaggaggaa
cctaaggttgttttgggtagcgcaactgtgacattgccggtccacgagggcctgtcgcca
tcattctcgagctcctccgaagatcctctcggttcattgcccacttttgacagtttctct
gaccttgattcggaggacgagtttgccaacaagctcgttgacttccaccctattggaaac
acctacttccagggagataaacggcaacgtctaggcacgtacctccttgatgaggacgag
ttcttgagtgaacgcagcttggaagatctggacgatcaagaggcctttgcccaatccggt
cttccctccgtggagtccactgactttctcgcagtcgagggtgatgctacacagagcact
gaggaaatgagctcgaagaagagagtcacttctcgcaggtcgcttaagaaggcgagcacg
tcggagagcagctcggacagccttgccaagaagactcaggcttccgccaccagccggtct
ggtcactccgacacgacttccaccgtccagcagtcgactgcttcttcgcgtcagaactcg
accgccaatacctccaactctgagtccccggctgctcctgtctctgtcaatcgtcgcgga
cgcaagcaatccttgaccgacgacccctcgaagacctttgtctgctcgctctgctctcgt
cgtttccgccgtcaggagcacctgaagcgtcattaccgctcgcttcacactcaggacaag
ccgtttgagtgccatgagtgcggtaagaagttctctcgcagcgacaaccttgctcagcat
gccaggactcacggtggtggttccattgtgatgggtgttatcgacacaaacagctcgaac
actcaacccgcgttcgatgagcctgagccgcgggctttgggcctcgctctgtacgaggcc
gccaacgccgcaacgagcaagtcgacgacgagcgagtcatccgatggaactatttcagac
acgtcgtccgtcggtgggcggcctgccaagaagcgccgacgggacgaccacgtctga

DBGET integrated database retrieval system