KEGG   Aspergillus fumigatus: AFUA_4G09130
Entry
AFUA_4G09130      CDS       T01017                                 

Definition
(RefSeq) mannosyltransferase
  KO
K05286  GPI mannosyltransferase 3 [EC:2.4.1.-]
Organism
afm  Aspergillus fumigatus
Pathway
afm00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    AFUA_4G09130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:afm01003]
    AFUA_4G09130
Enzymes [BR:afm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     AFUA_4G09130
Glycosyltransferases [BR:afm01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   AFUA_4G09130
SSDB
Motif
Pfam: Glyco_transf_22
Other DBs
NCBI-GeneID: 3509380
NCBI-ProteinID: XP_751912
UniProt: Q4WPG0
Position
4
AA seq 771 aa
MSSSRRRKSFTSSSSSSSPSFHSPPPTSRLRPRSPPSSNTKTSPTSTTPLATNILLSLIA
FRLVNAFTVRTFFQPDEFFQSLEPAWQIAFGENQGAWITWEWRHQLRSSIHPLLFAAVYS
AADVVAQLLRLSLASRADLLVAAPKTAQAVIAGLGDFYTWKLARYVYGARSYEAWATLAL
TVVSPWQWFCSTRTLSNCLETTITIVALYLWPWSWSFETPVRKKATRAASRERAQRGPEG
SDSLQRLRQCLSLAAVACILRPTNILIWMGLASVAWFRTSWDRRAILVREVLLCGCAVLG
LSCVVDRLFYGSWTFPPLRFLYFNIAQSLAVFYGRNDWHYYVSQGFPLLLTTALPFALVG
LYRALAQVRTFGLGHLQSLVQAQLALICVIMPFVLSLVSHKEVRFIYPLLPSLHILSAPP
LVDYFLPAVIRSSRSYTPRRLTLIFLLLVNIVIALYTTIYHASGPSNILSYLRQQHELHA
PAAQTPSNLRPSVKDPSPHGITAGFLMPCHSTPWRSHLIYPTIHAWALTCEPPVDQTAAQ
KATYIDEADQFYANPARFLREHMAGGLRHISRKPSYLSAQPRPQHPSTTSTNDASHEWPD
YLIFFAQLEPTLQSLLRASSYAECYRTFNTAWHDDWRRKGDIVAWCLDPAEQQAWRSATR
QRDLENRERQFDRIIESFRKEASGKRDGKLSPFRRWFSSSSSVAPSSSLSLSWPTSWRWP
WGQRKRTAWLGVQIPQWTRTRPSWTAWGGDWFGGWRQKKKTKKLLERDLWS
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgtcctcgtcgcgtcgaaggaagtccttcacgtcatcgtcctcttcgtcgtctccgtcg
tttcactccccaccgccgacttcgcgcctgaggccgcggtctcctccatcaagtaatacc
aaaacatcaccgacatcaacaacgccgttggcaaccaatatccttctgtccttaatcgct
tttcggctggtcaacgcattcactgttcgcaccttcttccaacccgatgaattttttcag
tcccttgaacctgcctggcaaatcgcgtttggagaaaaccagggggcatggataacctgg
gaatggaggcatcaactgaggtcttccatccatcctctcctcttcgccgctgtctactcc
gccgccgatgtcgtcgcccagcttctccgcctctccctcgcatcgcgtgcggatcttctc
gtcgccgctcccaagactgcgcaggcggtaatcgcggggctcggggacttttatacttgg
aagttggctcgctatgtctatggcgctcgaagttacgaggcttgggctactcttgccttg
acggtcgttagcccatggcaatggttttgttcgaccaggacattgtcgaattgcctggag
accacgattaccattgtcgctctctacttgtggccctggagttggtcatttgagacaccg
gttcgcaagaaggctactcgcgcggccagcagggagcgtgctcagaggggtccagagggg
tcagactcgctacaaaggctacgtcaatgcctatccctagcagctgtcgcctgtattcta
cgaccgacaaatattctcatctggatgggtttggccagtgtcgcatggtttcgaacttct
tgggacaggagggcgattctggtacgcgaagtattgctttgcgggtgtgccgttcttggt
ctatcgtgcgtggtggatcggctcttctacggaagctggacctttcctcctttgagattc
ctgtactttaacattgcacagtctcttgcggtcttctatgggagaaatgactggcattat
tatgtctcgcaagggtttccccttttacttaccaccgcactgccgttcgctctcgttggc
ctgtaccgcgctctggcccaagttcgaacgttcggcttggggcacttgcagtctctcgtg
caagcgcagcttgcgctgatatgcgtaattatgccttttgtcctgtccctggtttctcac
aaggaagtgcgattcatctatccgcttctaccatctctccacatccttagcgcaccacct
ctggtggactacttcctccctgcagtcatccgctcgtcccgatcatatacgcccaggcgg
ctcaccctcatcttcctattgctggtcaatatcgttattgccctctacacgaccatctac
cacgcatccggaccgtccaatatcctttcatacctccggcaacagcacgagctacatgct
ccggctgctcaaactccttcgaacctcaggccctcagtcaaagacccctctccgcacgga
atcacagccggcttcctcatgccctgccacagcaccccctggcgctcccacctcatctac
cccacaatccacgcctgggctctaacctgtgagccccccgttgaccaaaccgccgcccaa
aaagccacctacatagacgaagcagaccaattctacgccaaccccgcccggttcctccgc
gagcacatggccggcggcctccgccacatctcccggaaaccatcctatctctccgcgcaa
ccacgcccccagcacccgtcgacgacaagcaccaacgacgccagccacgaatggcctgac
tacctcatcttcttcgcgcaactcgagccaaccctgcagtccctcctccgcgccagctcc
tacgccgaatgctaccgcaccttcaacacagcctggcacgacgactggcgccgcaaaggc
gacatcgtagcctggtgcctcgaccccgccgaacaacaggcttggcgatccgccacccgc
caacgcgacctcgagaaccgcgagagacaattcgaccggatcatcgagagtttccggaaa
gaagcgagcgggaagcgcgatggcaagctctcgccgttccgtcggtggttttcgtcttcg
tcttctgttgccccgtcgtcttcgctctctctgtcgtggccgacgtcgtggcgctggccg
tggggccagcgaaagcggaccgcctggttaggcgtgcagattccgcagtggacaaggaca
cggccgtcgtggacggcttggggaggggactggttcgggggttggaggcagaagaaaaag
acgaagaaacttcttgagcgggatctgtggtcgtaa

DBGET integrated database retrieval system