KEGG   Aspergillus fumigatus: AFUA_4G11080
Entry
AFUA_4G11080      CDS       T01017                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase FacA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm00010  Glycolysis / Gluconeogenesis
afm00620  Pyruvate metabolism
afm00630  Glyoxylate and dicarboxylate metabolism
afm00640  Propanoate metabolism
afm00680  Methane metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_4G11080
   00620 Pyruvate metabolism
    AFUA_4G11080
   00630 Glyoxylate and dicarboxylate metabolism
    AFUA_4G11080
   00640 Propanoate metabolism
    AFUA_4G11080
  09102 Energy metabolism
   00680 Methane metabolism
    AFUA_4G11080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:afm01004]
    AFUA_4G11080
Enzymes [BR:afm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AFUA_4G11080
Lipid biosynthesis proteins [BR:afm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AFUA_4G11080
SSDB
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Other DBs
NCBI-GeneID: 3508995
NCBI-ProteinID: XP_751720
UniProt: Q4WQ02
Position
4
AA seq 670 aa
MSDGDVKPAKPAVVLEANDVDTFHVPKAFYEKHPSKTHLKDLDEYKKLYDESIRSPDTFW
ARMARELLTFDKDFQTTHIGSLENGDNAWFVEGRLNASFNCVDRHAIKNPNKVAIIYEAD
EPNEGRIITYGELLREVSRVAWVLKQRGVKKGDTVAIYLPMIPEAVVAFLACARIGAIHS
VVFAGFSSDSLRDRVLDAGSKVVITTDEGKRGGKVIGTKRIVDEALKQCPDVTSVLVYKR
TGAEVPWTNGRDIWWHEEVEKYPCYVAPESMSSEDPLFLLYTSGSTGKPKGVMHTTAGYL
LGAAMTGKYVFDIHDDDRFFCGGDVGWITGHTYVVYAPLLLGCSTVVFESTPAYPNFSRY
WDVIEKHKVTQFYVAPTALRLLKRAGDEHIHHKMEHLRILGSVGEPIAAEVWKWYFEKVG
KEEAHICDTYWQTETGSHVISPLGGITSTKPGSASLPFFGIEPAIIDPVSGEEISGNDVE
GVLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHDGYYWIRGRVDDVVN
VSGHRLSTAEIEAALIEHHQVAEAAVVGIADELTGQAVNAFVSLKDGNETTEQVRKDLVM
QVRKSIGPFAAPKAVFVVEDLPKTRSGKIMRRILRKILSGEEDSLGDTSTLSDPSVVNKI
IETVHAARAK
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgtctgacggcgacgttaagcccgcaaagccggccgtggtgctcgaggccaacgatgtc
gacactttccacgtccccaaagctttctatgagaagcacccttcgaagactcatctgaaa
gatttggacgagtataagaaactatacgacgagtctatccgtagccctgacacgttctgg
gcccgcatggcccgtgagctgctcactttcgacaaagacttccaaaccacgcacatcggg
tcgctcgagaatggagacaatgcctggttcgtcgaaggtcgcttgaatgcctcgttcaac
tgcgtggatcgtcatgccatcaagaaccctaataaggtcgcgatcatctacgaggccgat
gagcctaatgagggccgcatcattacctacggcgagctcctccgcgaagtctcccgcgtt
gcctgggtcctgaagcagcggggtgtcaagaagggtgacactgtcgcgatctaccttccc
atgattcctgaagccgttgtggcttttctcgcctgtgcccgtatcggtgccattcactcc
gttgtcttcgctggtttctcctcggactccctgcgtgaccgtgtccttgatgctggatcc
aaggtcgttatcaccacggacgagggtaagcgtggtggcaaggtgattggcaccaagcgc
attgtcgatgaggccctcaagcagtgccccgatgtgaccagtgtgctggtctacaagcgc
actggtgccgaagtcccttggaccaatgggcgtgacatttggtggcatgaggaggtcgag
aagtacccctgctatgtcgctcctgagtcgatgagctccgaggaccccctcttcctcctc
tacacctctggttcgactggtaagcccaagggtgttatgcacactactgccggctacctc
cttggtgccgcgatgaccggcaagtacgtctttgacattcatgacgacgatcgcttcttc
tgcggtggtgacgttggctggatcaccggacacacctacgtcgtctatgcgcctcttctt
cttggttgctctaccgtcgttttcgaaagcactcccgcctaccccaacttctcccgctac
tgggatgtcattgagaagcacaaggtcacccagttctatgtcgcccccacagctctgcgt
ctgctgaagcgtgccggtgatgagcacatccaccacaagatggagcacctgcgtatcctg
ggctccgtcggtgaaccaattgccgctgaggtctggaagtggtactttgagaaggtcgga
aaggaggaagctcacatttgcgacacctactggcaaactgagaccggctcgcacgtcatc
agtcccctcggtggaattacttccaccaagccaggcagtgcatccttgcccttcttcggc
attgaacccgctatcatcgaccccgtctccggcgaggagatctctggcaacgatgtcgag
ggtgttcttgctttcaagcagccttggcctagcatggcccggaccgtgtggggtgcccac
aagcgctatatggacacatacctgaacgtctacaagggctactacttcactggagatggc
gctggccgtgaccacgacggatattactggattcgcggtcgtgtcgacgacgtggtcaat
gtctctggacaccgtttgtctactgctgagatcgaggccgctcttattgagcaccaccag
gttgccgaagcggctgtcgtcggtattgccgatgaactcactggccaagctgtcaacgcc
ttcgtttctctcaaggacggcaacgagaccaccgaacaagtccgcaaggatcttgtgatg
caagttcgcaagtcaatcggtccatttgccgcacccaaggcggttttcgtcgtagaagac
cttcccaagacccgcagtggcaagattatgcgccgtatcctacggaagattctgagcggt
gaagaagatagcttgggtgatacctcaaccttgtcggatccttccgtggtcaacaagatc
attgagactgttcatgctgcccgagccaagtag

DBGET integrated database retrieval system