KEGG   Aspergillus fumigatus: AFUA_5G06040
Entry
AFUA_5G06040      CDS       T01017                                 

Definition
(RefSeq) UV excision repair protein (RadW)
  KO
K10839  UV excision repair protein RAD23
Organism
afm  Aspergillus fumigatus
Pathway
afm03420  Nucleotide excision repair
afm04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:afm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AFUA_5G06040
  09124 Replication and repair
   03420 Nucleotide excision repair
    AFUA_5G06040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:afm03051]
    AFUA_5G06040
   03400 DNA repair and recombination proteins [BR:afm03400]
    AFUA_5G06040
Proteasome [BR:afm03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    AFUA_5G06040
DNA repair and recombination proteins [BR:afm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      AFUA_5G06040
SSDB
Motif
Pfam: UBA XPC-binding ubiquitin Rad60-SLD Rad60-SLD_2 Ubiquitin_5 DUF2407 Pneumo_att_G
Other DBs
NCBI-GeneID: 3511086
NCBI-ProteinID: XP_754028
UniProt: Q4WTT6
Position
5
AA seq 376 aa
MKLTFKDLKQQKFVIEAEPSETVGQVKEKISKEKGWEVPQLKLIYSGKILQDDKTIETYN
IEEKGFIVCMVSKPKAPSSAATPSQAPSTPSRAAASTPAAPSAPAPSAAPSAPAVPATPS
PAAPAPAPTDASAAFNDPSALLSGSQSEAVISQMESMGFPRSDINRAMRAAFFNPDRAIE
YLLNGIPDNIQQEQQQQAAAAAAAPRPSAPSGESAPSSTGGDEPVNLFEAAAQAGTGEGT
GRGARAGAVGAGEGLPNLDFLRNNPHFQQLRQLVQQQPQMLEPILQQVAAGNPQIAQLIG
QNEEQFLQLLSEEDDGALPPGTHAISVTEEERDAIERLCRLGFSRDLVIQAYFACDKNEE
LAANYLFENPDDPDDM
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaagctcacattcaaggatctcaaacagcagaaattcgtaattgaagcagagccctcg
gagacggtcggacaagtaaaggagaagatttccaaggaaaaaggatgggaggtacctcag
ctcaagctcatctattccgggaaaatcctccaagatgacaagaccatcgagacatacaac
attgaggagaagggtttcatagtatgcatggtatcgaagcccaaggctccctcgtctgcc
gctacaccttcacaggccccttcgacaccttcgagagctgctgcctccacgcctgctgca
ccatctgctcctgccccgtctgctgccccttctgctccggctgtacctgccaccccctca
cccgccgctccggctccggcacccaccgatgcgtctgctgcgttcaatgacccgtctgca
ttgctgagtggctctcagagtgaggctgtcatcagtcaaatggagagcatgggcttcccc
agaagcgatatcaaccgtgccatgagagcggcgttcttcaaccctgatcgtgctattgag
tatcttttgaatggaatccccgacaacatccaacaagagcagcagcaacaggctgctgca
gccgccgcggctccccgcccgtccgccccttccggagagagtgctccctcgtcgaccggc
ggtgatgagccagtgaatttgtttgaagccgctgcccaggccggcactggagagggtact
ggtcgtggagctcgtgccggtgctgtcggagctggggaaggactgcccaacctcgacttc
ttgcggaataatcctcactttcagcagctccgccagttggtccagcaacaaccacagatg
ctggaacccatccttcagcaagtcgccgctgggaacccccagattgcacagctcatcggt
cagaacgaggagcagtttctccagctcttgagtgaagaggatgatggcgcgctgcctcca
ggcacccatgcaatcagcgttacagaggaggagagagacgccattgaacgcctttgccgg
cttggtttctctcgcgacctggtcatccaggcctattttgcctgtgacaagaacgaagag
ctcgcagctaattacctctttgagaaccctgatgatcctgacgacatgtga

DBGET integrated database retrieval system