KEGG   Aspergillus fumigatus: AFUA_5G06130Help
Entry
AFUA_5G06130      CDS       T01017                                 

Definition
(RefSeq) succinyl-CoA synthetase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
afm  Aspergillus fumigatus
Pathway
afm00020  Citrate cycle (TCA cycle)
afm00640  Propanoate metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
afm01200  Carbon metabolism
Module
afm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFUA_5G06130
   00640 Propanoate metabolism
    AFUA_5G06130
Enzymes [BR:afm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     AFUA_5G06130
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AFUA_5G06130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 3511183
NCBI-ProteinID: XP_754019
UniProt: Q4WTU5
Position
5
AA seq 331 aa AA seqDB search
MQAFRRSTLSALRNAAAVQRRAYSQGSSIYSETVNNLRINADTKVIFQGFTGKQGTFHAE
QAIAYGTKVVGGTNPKKAGTMHLDRPVFANVSEAVKETGATASAIFVPPPLAAAGIEEAI
AAEVPLVVCITEGIPQHDMVRITDILKTQNKTRLVGPNCPGIIAPGQCKIGIMPGFIHKR
GRVGIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFIDCLKIFLEDEETDGII
LIGEIGGSAEEDAAEFFKANNKHNKPAVGFIAGISAPPGRRMGHAGAIVSGGKGGADSKI
AALESAGVTVERSPAHLGKTLLAEFVKRDLV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcttttcgccgtagtaccctctctgccctacggaatgccgctgctgtgcagcga
cgagcttacagccagggtagctcgatctactctgagactgtgaacaacctgcgcattaat
gcagataccaaggttatcttccagggtttcaccggaaagcagggaactttccacgccgaa
caagccattgcctacggaaccaaggttgtcggtggtaccaaccccaagaaggctggtacg
atgcaccttgatagacctgttttcgcaaatgtcagcgaggctgtgaaggaaactggtgcc
actgcctctgctatcttcgtccctcctcctctcgccgctgcgggtattgaggaggctatc
gcggccgaggttcccttggttgtttgcattacggagggtattcctcagcacgacatggtt
cgcatcacggatatcttgaagactcagaacaagacccgtctggttggacccaattgcccc
ggtatcatcgctcctggccaatgtaagattggtatcatgcctggattcatccacaagcgt
ggtcgtgtcggtattgtgtctcggtccggaaccctgacatacgaggctgtcaaccagacc
acccaggccggtctcggccagtccctcgtcgttggtatcggtggtgaccccttctccggt
accaacttcattgactgcctgaagatcttcctcgaggatgaggagacagacggtatcatc
ttgattggtgagattggtggcagcgccgaggaggatgctgccgagttcttcaaggccaac
aacaagcacaacaaacccgctgttggtttcatcgctggcattagcgctcctcccggtcgt
cgtatgggtcacgccggtgctatcgtcagcggtggtaagggtggtgctgactccaagatt
gcggccctcgagagcgccggtgtcactgtggagagaagccctgctcatcttggtaagact
ctgctcgctgaattcgtcaagcgggatctggtctag

DBGET integrated database retrieval system