KEGG   Aspergillus fumigatus: AFUA_5G06190
Entry
AFUA_5G06190      CDS       T01017                                 

Definition
(RefSeq) sexual development transcription factor SteA
  KO
K11215  transcription factor STE12
Organism
afm  Aspergillus fumigatus
Pathway
afm04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:afm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    AFUA_5G06190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:afm03000]
    AFUA_5G06190
Transcription factors [BR:afm03000]
 Eukaryotic type
  Other transcription factors
   Others
    AFUA_5G06190
SSDB
Motif
Pfam: STE zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zinc_ribbon_9 zf-C2H2_jaz NOA36 FYDLN_acid zf-TRAF zf-Di19
Other DBs
NCBI-GeneID: 3511526
NCBI-ProteinID: XP_754013
UniProt: Q4WTV1
Position
5
AA seq 688 aa
MYTQHGAQMAPPQKPETFMLSNEAQQSLPHDAQVALQQVDNLKYFLLSAPVDWPRDQLIR
RYLLPTGDYISCVLWNNLFHISGTDIVRCLAFRFQAFGRPVKNSKKFEEGIFSDLRNLKA
GTDATLEEPKSPFLDFLYKNNCIRTQKKQKVFYWYSVPHDRLFLDALERDLKREKMGQEA
TTLAVSEPALSFEFDSSQSLYEQLTKAQQANSSSFHAGTTFGQSNSPIVRTVDAMPPPQM
APPAMTVLQDDAGNQAMYSTMPMAHPLTQAIIKREPDYGQIQYDCNGIPIRIHQRHASMP
SFVVEYSPAPSFVSSQYEDYSNRGLSFEPVTPPQHSVPLGPEPAYIANEDTGLYTAIPDI
TSAATFNPMMQLPPSNLASASYPMPARTYHSNVYSVIEGSPTYKQRRRRSSIPPSAAANG
HAQTTSAPSQQIAYAAHRPSDLRRSVSNSVVPAAEGEDTHEASNHGANGYTSAVLPQRNL
LHDMSRNGTPLSNVEENPESNPQTTGHQDDLVTLPNGEAYEGGVQNNVSNKVERFTPGPI
RRARSATMMELGPYPQKSHSCPIPSCGRLFKRLEHLKRHVRTHTQERPYPCPYCNKAFSR
SDNLAQHRRIHEAQQDGQQPLPTHDEDLENEENELGSDRESSPGEAIPSSMANVMGLTSM
PSTMPLTSSMPSMMAPQMIAPQLLQQQI
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgtatactcaacatggtgcccaaatggcacccccgcaaaaaccggagacgtttatgttg
tcgaacgaagcgcaacaaagtctccctcacgatgcgcaagttgcgcttcaacaggttgat
aatttgaagtacttccttctttcggcgcccgtagactggccaagggaccaactgattcgc
cgatatctactgcccaccggcgattatatttcctgcgttctctggaacaacctgttccac
atctccggcactgatatcgtccgatgtctcgcctttcgttttcaagcctttggccgtccg
gtcaaaaactcgaagaagtttgaggagggtattttctccgatcttcgaaatctgaaggct
ggcaccgatgcgacactcgaagaacccaaaagcccctttctcgattttctctataagaac
aactgcatcaggacacagaagaagcagaaggtcttttactggtacagtgtgccacacgat
aggctattcctcgatgcgctggaacgtgacctgaagagggagaagatggggcaggaggcg
accactcttgcggtcagcgagccggccttgtcgtttgaatttgactcgtcgcagtcgttg
tatgagcaactgacaaaggcacaacaagcaaattcatcatcctttcacgcgggtacgaca
tttggccagtccaactccccaattgttcggactgttgacgcaatgcctcctccccagatg
gctcctcccgcgatgacagttctccaagacgatgctggcaatcaggcgatgtacagtacg
atgcccatggctcatcccctgacccaggccataattaagcgcgagcccgactacgggcag
atccagtatgattgcaatggcatcccgatccgcatacaccagcggcatgcttccatgcct
agttttgttgtcgagtattcgcctgcaccgtcctttgtttcctcacagtacgaagactac
agcaaccgcggcttatcgttcgaacccgtcaccccaccacagcacagcgttccacttggg
cctgaaccggcttatatcgcaaacgaggacacaggtctctacactgcgattcctgacatt
acttctgcagccaccttcaatcctatgatgcagctaccgccgtcaaacctagcaagcgcg
tcttacccgatgcctgccaggacataccattcgaacgtatattcggtgattgaggggtct
ccaacgtacaagcaacgtcgtcgtcgctcttcaattccaccgagtgccgcggctaatgga
cacgcccaaacaacatccgcaccatctcagcagattgcgtatgccgcccatcggccgagt
gatctccgacgttccgtctcaaattcggtggtgccggcagcagaaggggaggacacacat
gaagcttctaatcatggcgcaaacggatatacttctgcagttctcccacagaggaatttg
ttgcacgatatgtcccgcaacgggaccccgctctcaaatgtcgaggaaaatcctgagtcg
aatcctcagacgacgggccatcaggatgacctggtcacgcttcccaatggagaagcgtac
gagggaggtgtgcagaacaatgtttcaaataaagtggagcgatttactcctggccccatt
cgccgcgcccgaagtgctacaatgatggagctaggaccataccctcagaagtctcactcg
tgcccgattccatcgtgcgggcggcttttcaagcgattggaacatctcaaacggcatgtg
cgcacccacacacaagagcgaccttatccctgtccttattgcaataaagccttctcccgc
tccgacaatcttgcgcaacatcgtcgtatccacgaggctcaacaggatggccagcaacca
cttcctacacacgacgaagaccttgaaaacgaggagaacgaacttggatcagacagagaa
tcatcgcctggcgaagctatacccagttctatggccaatgtcatgggcttgacatcgatg
ccttcgacaatgccgctgacctcttcgatgccgagcatgatggctccccaaatgatcgct
ccccagcttctgcagcagcaaatctga

DBGET integrated database retrieval system