KEGG   Aspergillus fumigatus: AFUA_5G06700
Entry
AFUA_5G06700      CDS       T01017                                 

Definition
(RefSeq) serine/threonine protein phosphatase PPT1
  KO
K04460  serine/threonine-protein phosphatase 5 [EC:3.1.3.16]
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:afm01009]
    AFUA_5G06700
Enzymes [BR:afm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AFUA_5G06700
Protein phosphatases and associated proteins [BR:afm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    Catalytic subunits
     AFUA_5G06700
SSDB
Motif
Pfam: PPP5 Metallophos TPR_1 TPR_2 TPR_11 TPR_19 TPR_16 TPR_9 TPR_6 MIT Fis1_TPR_C TPR_14 TPR_8
Other DBs
NCBI-GeneID: 3511024
NCBI-ProteinID: XP_753963
UniProt: Q4WU01
Position
5
AA seq 480 aa
MAASDLEAATALKVQGNKAFAEHEWPTAVEFYTQAIDKYDREPSFFSNRAQAYIKLEAYG
FAIADATKALELDPSYVKAYWRRALANTAILNYREALKDFKAVVKKEPNNRDAKLKLAEC
EKLVRRLEFEKAIEVGEPPSAFEDLDIDAIAVDSSYDGVRLEKEMTQEFIDDMIERFKNG
KKIHRKYAFQIIKAVKDIVYAEPTMVEIGVEEGTKLTVCGDTHGQFFDLLNIFNINGYPS
ETHAYLFNGDFVDRGSWSTEIALLLYAYKWLRPNRIFLNRGNHETDDMNKVYGFEGECKA
KYNERLFKVFSESFSALPLATLIGSKYLVLHGGLFSDDKVTLDDIRKLNRHNQRQPGQQG
LMMEMLWTDPQTEPGRGPSKRGVGLQFGPDVTKRFCEKNGLEAIIRSHEVRMEGYEVEHD
GRCITVFSAPKYCDTTENKGAFINIGPELKLDFKVFEAVPHPDIRPMVNPVLSCLLKLQS
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggctgcatccgatctcgaggccgccaccgcactgaaagtgcaagggaacaaggcattt
gccgagcatgaatggcctaccgcagtcgagttctacacgcaggcgatagacaagtacgat
cgggaaccgtcgttcttcagcaaccgggcgcaggcatatatcaaacttgaggcgtatggt
tttgcgatcgcggatgccaccaaggctctggagctggacccctcgtatgtcaaggcatac
tggagaagagctcttgcgaacaccgccatattgaactaccgcgaagccctcaaagacttc
aaggctgtcgtgaaaaaggagcccaacaaccgcgatgcgaaactaaagctggcagagtgc
gagaagcttgtgcggcggttagagtttgagaaggcaattgaggttggggagccgccgtct
gcgtttgaggacttggacattgatgcgattgccgtcgattcctcctatgacggtgttcgg
ttggagaaggagatgactcaagaattcatcgatgatatgattgagaggttcaagaacggc
aagaagatccatcgcaagtacgcgttccaaatcatcaaggctgtcaaggatatcgtctat
gcggaaccgacgatggtcgagatcggtgtggaggagggtactaagttgacggtttgtggt
gacacacacggccaattcttcgaccttctaaacatcttcaacataaatggctacccctcc
gagacgcacgcatacctcttcaacggcgacttcgtcgaccgtggttcgtggtccaccgag
attgccctgctcctctacgcatataagtggctccgccccaaccgcatcttcttgaatagg
ggcaatcacgagaccgatgacatgaacaaggtctatggtttcgagggtgagtgcaaagcc
aagtacaacgaacgcctgttcaaggtcttttccgagtccttctccgcgctgcccctggcc
acattgattggcagcaagtatcttgtcctgcacggtggcctcttctctgacgacaaggtc
accttggacgatatccggaaactgaaccgccacaaccaacgacagcccggacaacaaggc
ctgatgatggagatgctctggacggaccctcagaccgaaccgggccgcgggcccagtaag
agaggcgttggcctgcagttcgggcccgatgtaacgaagcgcttctgcgagaagaacggg
ctagaagccatcattcggtcgcacgaggtccgcatggaaggttacgaggtcgagcacgac
ggacggtgcatcaccgtcttctctgcacccaaatactgcgacactaccgagaacaagggc
gcattcatcaacattggacccgaactcaagcttgacttcaaggtctttgaagcagtgcct
catcctgacatcaggccaatggtaaaccctgtcctttcgtgtctgctcaaattacaaagc
tga

DBGET integrated database retrieval system