KEGG   Aspergillus fumigatus: AFUA_5G08470
Entry
AFUA_5G08470      CDS       T01017                                 

Definition
(RefSeq) AMP-binding enzyme
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 3511430
NCBI-ProteinID: XP_753790
UniProt: Q4WUH4
Position
5
AA seq 570 aa
MLVDQESVISKHQNYRLTYASLDAKSNALARGLESVGVRKGDRVGVMLGNSSEYAIATYA
LFKLGAILVPLNPSFNATQVISALSHLGAAHLIISAESNLPRKEPRSNVPLLKHLVQDLH
TGKVESAVVPSVKNVIFVDNSSGRVKWSDYKSLTPFTSVISDNVADANPLPPQDLSPSDV
VNIQFTSGTTAMPKAACLSHRSILNNGSQIGDRMRLTAKDIVCCPPPLFHCFGCILGYMA
TATHGSAIVFPTESFNARATLKAVQEEKCTALYGVPTMFLEELGLLQEGEVEHKGFEFLR
TGIAAGSSIPEALMKKLHKVLNLTELTICYGMTETSPVSAMTATDDPLDKRISTVGRLMP
HVEAKVVDPADRSKILPINTRGELAVSGYLLMKEYWGDPHRTAEVMIADQEGKIWMHTGD
EASMSPDGYITITGRIKDLIIRGGENIHPLEIENCLLTCPGVADVSVVGVPDERYGEVVA
AFIICKEQDRRTVAEDKIRDWVRERLSNHLAARHPSYLNMLTKTNLLIVPKYVFFLSPSD
SFPKTASGKVQKFKLKETAIKILKEQSNAN
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgcttgtggaccaagagagcgtcatatcaaaacatcagaattacagattgacctacgcc
tcactcgatgccaaaagtaatgcccttgcgcgaggactggaatcagtgggtgtgcggaaa
ggggaccgtgtcggcgtcatgcttggaaattcttccgagtatgccattgcaacctatgca
ttgttcaaactcggagccattttggtaccccttaatccgtcgtttaatgcaactcaagtc
atctcggcgttgagccaccttggagccgcccatttgatcatcagtgccgagtccaattta
ccgcggaaagaaccccggagcaatgtcccactactcaagcaccttgtccaggatctccac
acaggaaaagtagagtccgcagtggtgccttcagtgaagaatgtcatttttgttgataac
tcttctggcagagtcaaatggtcggactacaagagcctgacgcctttcacgtcggtcata
tcagacaacgtcgctgatgcgaatccactgcctcctcaggatctctcgcctagtgatgta
gtgaacatccaattcacgtctggcaccaccgccatgcctaaagcggcatgcctgagccac
cgctcaatcttgaacaatggttcccagattggcgatcgaatgcggttgaccgcaaaggac
attgtatgctgtcctccaccattgttccactgtttcggatgcattttaggctacatggca
accgctactcatggctcagccattgtattccctacggaatcattcaacgcccgtgccacc
ttgaaagccgtgcaggaggaaaaatgtacagcactttacggcgtgcctaccatgttcctc
gaagagctcggcctgcttcaggaaggcgaagtagaacacaaagggtttgagtttcttcgg
acaggcatcgccgctggtagcagcattccagaagcgctcatgaagaagctgcataaggtc
ctcaatctcacagaattgaccatctgctacggcatgactgaaactagtcccgtttcggcc
atgacagcgaccgatgacccattagacaagcggatcagtaccgttggtagattaatgcct
catgttgaagccaaggtcgtcgatccagcggatcgaagcaagatactccccatcaacacc
cgaggcgagcttgctgtgtctgggtacttgctaatgaaggagtactggggtgatccacac
aggaccgctgaagtgatgatcgcagaccaagaagggaagatctggatgcatactggcgac
gaagcctccatgtcaccggatggctacatcacgatcacgggccgtatcaaagatctcatc
atccgaggaggcgagaacattcaccctctagagatcgagaactgtctccttacctgcccc
ggcgtggccgatgtgtctgttgttggtgttccagacgagaggtatggcgaagtggtggct
gctttcattatttgcaaagagcaggatcgcaggacagtggccgaggacaagatcagagac
tgggttcgcgagcgactgagtaaccacctcgcggcaagacatccttcatacctcaatatg
ctaaccaaaaccaacttgctaatagttccgaaatatgtttttttcctttcaccttccgat
tctttccccaagactgcgagcggcaaagttcagaagttcaagctgaaggagactgccatc
aagattctgaaagagcagagcaatgctaattag

DBGET integrated database retrieval system