KEGG   Aspergillus fumigatus: AFUA_5G09290Help
Entry
AFUA_5G09290      CDS       T01017                                 

Definition
(RefSeq) short chain dehydrogenase/reductase family oxidoreductase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
afm  Aspergillus fumigatus
Pathway
afm00072  Synthesis and degradation of ketone bodies
afm00650  Butanoate metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AFUA_5G09290
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AFUA_5G09290
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     AFUA_5G09290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR UPF0146 DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 3510863
NCBI-ProteinID: XP_753710
UniProt: Q4WUQ4
Position
5
AA seq 319 aa AA seqDB search
MAFSVKGKSAIVTGAGSGINLCFAKLLLENGCNVLIADLALRPEAQEVVNYYSSQPSRPN
RAVFQKTDVVDWEQLERMFEVAVREFGDVDIVCPGAGIYEPHWSNFWRPPGAPESRDPRD
GGRYALLDINLTHPIRTTQLAISHFLRNRSSKRPKHIIHISSIAGQSPALAAPIYVATKH
AINGLVRSLAKLDSKFGIRVTAVAPGVIKTPLWTDHPEKLKMVDDKADEWVTPEEVAEVM
LALIQQDSVSEIIGDKSGQGTQFPVQGGTILEVSKSVRAVSPFNDPGPAGRRGNTVSDMA
KVEDEEYGDMVWSTESIRR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctttctccgtcaaaggaaaatccgccattgtaacgggtgcaggttcaggcatcaac
ttatgtttcgccaaactcctgcttgagaatgggtgcaacgttctaatcgcagacctggcc
cttcgacctgaggcgcaggaggtggtgaattattattccagtcaaccaagcagacccaat
cgagctgttttccagaaaacagatgtcgtcgactgggagcagctagagagaatgtttgag
gttgcggtgagagagtttggtgatgtcgacattgtatgtccaggtgctggaatctacgaa
ccgcactggtccaatttctggcgacctccgggggctcccgaaagccgtgatccacgagat
ggaggtcgatacgctttgctagatatcaatctgactcatccaatccgcacaactcagttg
gctatatctcactttctgcgcaatcgaagtagcaaaagaccgaagcatatcatccatatt
tccagtattgcagggcagagcccagcactggctgcgccaatatatgtagctacgaaacac
gcgatcaatggtctggtgcgatcgttggccaagctggacagcaaatttggcattcgggtg
actgctgttgccccgggagtcatcaaaacaccactatggacggatcatccggagaaactg
aagatggttgacgacaaagccgacgaatgggtaaccccggaggaggtggctgaggtgatg
ctagctctcatccagcaggacagtgtcagcgaaattatcggagacaaatcaggccaaggc
actcaattccctgtgcaagggggaaccatcttggaagtctccaagagcgttcgcgctgtc
agtccattcaatgacccagggccagcaggacgacggggaaacactgtgtcggacatggcc
aaggtagaggatgaggaatatggagatatggtatggagcacggagtcgatccgcagataa

DBGET integrated database retrieval system