KEGG   Aspergillus fumigatus: AFUA_5G11010
Entry
AFUA_5G11010      CDS       T01017                                 

Definition
(RefSeq) nucleoside diphosphatase (Ynd1)
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: GDA1_CD39
Other DBs
NCBI-GeneID: 3510909
NCBI-ProteinID: XP_753547
UniProt: Q4WV67
Position
5
AA seq 719 aa
MAADYRVALGHYGIVLDAGSSGTRVHVYRWLDPAIARKHAKSDELKTLPEIKTKSEWTKK
IHPGVSSFADRPEVVGPEHLAELLDHARKIVPADQIKDTPIFLLATAGMRLLPNHERELL
LQQICSYASKNYDFLLPDCGVHIQVIPGVTEALYGWIATNYLLGSFDEPKGHDHGKGHHT
YGFLDMGGASAQIAFAPNITETEKHANDLTLLRLRNIDGSTQEHRVFVTSWLEFGVHEAR
RRYLEALQTAAGTAKELPDPCLPNGLRTTIDGKPLRTGDTSELSLLGTGRFDECLRQTYP
LLDKDAPCSDEPCLLHGVHVPAIDFDVNHFIGISEYWHTTHEIFEMAHKDKTYDFNTYQQ
RVQQFCTQDWEAIDQGIQKQSWGKKVDRESASEVCFKASWIINMLHNGIGIPRVGLEDTT
GSGHNGTKEVLSHGKEKGFLDPFQAVHKIHSTEVSWTLGKMVLYACSEVPVEVQEAQETL
PVGFGSNVPGVPNDFQYPSVELFPSNESLHVANWHDALFDGDSSRRVPGFLLFLVIVAMA
AFFLCGRSRRLRGYHMFKNLFKRGGAPHPSYPKKRRTFPGKLPFFGGSSHSYERVLEDGA
HEYDLGLVGSGRGSLDRRHSSDTDSSSFMPPKRTTTWSGPTTPSFKFALDNSSTSTIGLG
ITADSGVNAMDRAGLVVRTESRDHLAPVALGPTTNGRRSRAGSPTRSHRSPNVTPLDQD
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggcagctgactaccgtgtcgcattagggcattatggcatcgtcctggatgcgggatca
tctgggactcgagtgcacgtctatcggtggttggaccccgccatcgctcgcaagcacgct
aaaagtgatgagctgaaaacattaccggagatcaagactaaatctgaatggacgaaaaag
atacaccctggcgtgtcatcgttcgccgacagacccgaggtagtcggccccgagcatctt
gcggaacttctcgatcatgcacgcaagatcgtccccgccgatcagataaaggataccccg
atctttttactagccactgctgggatgcgactcttacccaatcatgagcgcgagcttctt
ttacaacagatctgctcctacgccagcaagaactatgattttctgcttcctgattgcggc
gtgcacattcaggtaatcccgggggtgacagaggccctctacggatggatcgcgaccaat
tatttgctgggcagcttcgatgaaccaaagggtcatgaccatggcaagggccatcatact
tatgggttcttggatatgggtggtgcatccgcgcagattgcctttgcgccaaatataacc
gaaaccgagaaacatgcgaatgacctgactctccttcggctacgaaacattgacggctct
acccaggagcatcgggtgtttgtgacatcctggcttgaatttggcgtgcacgaagctcgg
agacgttatttggaggccctacaaaccgcagccggaaccgcgaaggagcttcccgacccc
tgtctccccaatgggcttcgaaccacaattgacggcaaacctctgcggaccggcgacacc
tcggagttatctctgctgggaactgggcgattcgacgaatgcttgcgacagacatacccg
ctcttggacaaggatgcaccctgttcggatgaaccttgtcttcttcacggggtgcatgtc
cctgctattgactttgatgtgaatcatttcatcggtatcagtgagtactggcatacgacg
catgagatctttgaaatggcgcacaaggacaagacgtacgatttcaatacttatcaacag
cgggtacaacaattctgtacacaagattgggaagccatcgaccagggtatacaaaaacag
tcgtggggaaagaaggtcgatcgggaatcagcttccgaggtctgcttcaaggcttcatgg
atcatcaatatgctgcacaacggcatcggtatccctcgcgtgggtctcgaggacactact
ggttcaggtcacaacggaactaaggaagttctctcccatggcaaggagaaaggatttctt
gatccttttcaagcggttcacaagattcactccaccgaagttagctggacactgggtaaa
atggtgctctatgcatgctctgaggttccagtggaggttcaagaagctcaagaaacgctc
ccagttggctttggcagcaatgtcccaggtgttcccaatgacttccaatatcctagtgtc
gagttatttcccagcaatgagtcgcttcacgttgcgaattggcacgatgcgctctttgat
ggcgattcctcgcgcagggttccggggttcctacttttcctcgttattgttgcaatggct
gcattcttcctctgcggtcggagtcgtcgactgagaggttaccacatgttcaagaatctc
ttcaaacgcggaggtgcgcctcatccgagctaccctaaaaaacgaagaaccttccctggc
aaactaccattcttcggcggcagctcacattcatacgagcgcgttcttgaagacggtgcc
catgagtatgacctggggttggtaggctccggacgtgggtctctggacaggagacactcc
tcggacacggattcgagtagcttcatgcctccgaagcgaacaacaacctggagcggccca
accactcctagtttcaaatttgctttggacaattcgtccacatcgaccatcgggttggga
atcaccgccgactctggcgtcaatgccatggatcgggccggattggtcgtcaggacggag
agtagggaccacctggctccagttgcactcggcccaaccacaaacggccgtcgctctagg
gcaggcagtccgacaagatctcacagatcacccaatgtgactcccctagatcaagactaa

DBGET integrated database retrieval system