KEGG   Aspergillus fumigatus: AFUA_5G11690
Entry
AFUA_5G11690      CDS       T01017                                 

Definition
(RefSeq) protein tyrosine phosphatase Pps1
  KO
K04459  dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:afm01009]
    AFUA_5G11690
Enzymes [BR:afm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AFUA_5G11690
    3.1.3.48  protein-tyrosine-phosphatase
     AFUA_5G11690
Protein phosphatases and associated proteins [BR:afm01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    AFUA_5G11690
SSDB
Motif
Pfam: DSPc
Other DBs
NCBI-GeneID: 3511255
NCBI-ProteinID: XP_753481
UniProt: Q4WVD3
Position
5
AA seq 551 aa
MATVLVQQTLRHATPPPAGISSSLNLTRTPSPVPNKHLPVCPPGTSTAALRTAVQSTKED
KKVTSLLYPPDTFLRVNKSPSIYSIDIVTLAAALDYWASQPLPDPSQVFPWLHGLHPENH
LQLGFFTNRRRSLRRIPQCWRGITIVKVGGDLSTSRLKGAVSPSEILAPSGWDFIPSDPK
EGFSVRNFQIQTPKLATLSDIVVYGQDGVHKKQLLEVAEKIATAQYRWRNKNDPDGLLPT
YHTFILSIHWERLEMCEMTKASEISKNVWQGPTPDYILQCGSGDSVHVEDFDLLIETSDL
ASIPGPRYLAKLNRQLDDDDGPLRLEFPSSGSLVVPSAETREIDDLVSTVRWIYYLANPD
EPESPTDVGGDIAMTPLQRKPRRILIHCPDGYTESSLLVIAYLMFAEGIPAHEAWLRLHC
DRKRNFFAYPSDVTFLSTIQTRLLHESPATHSESLSSVPDPPWFRYCDGSLPSRILPYMY
LGNLGHANNPEMLWALGIRRILSIGESVSWRDFDIARMGPENVMHITQVQDNGIDPLTQE
FDRCLEFISEF
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggctacggtgttggtacagcaaacgctgcgacatgccacccctccgccagcgggaatc
tcctcgtccctgaatctcaccagaaccccgtcgccggtgccaaacaaacatttacctgtg
tgtccgccggggacttcgacagcagctttgcggactgctgtacaatcaactaaagaggat
aagaaggtcacgtcgcttctctatcctcccgacacgttcttgcgtgtaaacaaatccccc
tcgatatactcgatcgacattgtaaccttagccgccgccttggattattgggcttctcaa
cccttgccagatcccagccaggtatttccttggctccatggacttcacccggaaaatcat
ctacaactggggtttttcacaaaccggagacgttctcttcgccggattcctcaatgttgg
aggggcatcacgatcgttaaagtcggtggtgatcttagtacatccagactcaaaggtgcc
gtgtctcccagtgagatccttgccccgtccggctgggatttcattccaagcgaccccaag
gagggattctctgttcgcaattttcagatacaaaccccaaagttggctactctatcagac
attgttgtctacggccaagacggtgtccataaaaagcagctcttagaagttgctgagaaa
atcgccactgcacagtaccgttggagaaataagaatgacccagatggcttgcttccaacc
taccatacattcatcctctcaattcactgggagcggctcgaaatgtgcgagatgaccaaa
gcttctgagatctctaaaaatgtctggcaagggccgactcctgattacatattgcaatgt
ggatcaggcgactccgtgcatgtcgaagattttgaccttttgattgagacaagtgatctt
gccagcatccctggccctcgatacctggctaaactcaataggcagctggatgatgacgac
ggccctctgcggctagaattcccgtcttccgggtcgcttgtcgtcccatccgctgaaaca
agagaaatagacgacctcgtaagcactgtacgatggatctattatctagcgaacccagac
gagccggaatctcccacagatgttggtggagatattgctatgacgcctcttcaacggaag
cctcgcaggattcttatacactgtccagacggctatactgagtcttcactattggtcatc
gcttacttgatgtttgctgaaggtataccggctcatgaggcatggctgcgacttcattgc
gacaggaagcgtaatttcttcgcatacccgtctgatgtcacttttctgagcaccattcaa
acaagacttttgcatgagagtcctgcgacgcactcagagagtctctcgagcgttccagat
ccgccatggttccggtactgtgatggatcacttcccagtcgaattctcccatatatgtat
cttggcaatctgggccacgccaacaatcctgaaatgctctgggctcttggaattcggcgc
attctgagcattggagagtcagtctcatggagagattttgacattgctcggatgggccca
gagaacgtgatgcatataactcaggttcaagacaatggaatagacccgttgactcaggaa
ttcgaccgatgcttggaattcatcagtgagttctga

DBGET integrated database retrieval system