KEGG   Aspergillus fumigatus: AFUA_5G11870
Entry
AFUA_5G11870      CDS       T01017                                 

Definition
(RefSeq) WD repeat protein
  KO
K15361  WD repeat-containing protein 48
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:afm03400]
    AFUA_5G11870
DNA repair and recombination proteins [BR:afm03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     AFUA_5G11870
SSDB
Motif
Pfam: DUF3337 WD40 Ge1_WD40 ANAPC4_WD40 Nup160
Other DBs
NCBI-GeneID: 3511474
NCBI-ProteinID: XP_753464
UniProt: Q4WVF0
Position
5
AA seq 1051 aa
MARKPSHQRVTYVLPLPDAPGGHRLGVNSLTVDEDNSILYSAGRDGVICAWDLNLPLSAS
KSSPALGAQKSGPTTFRHQVQAHSHWINDIVLTQNNTALVSASSDTTVRLWRPHSESTEL
PSPIGKHADYVKALATPGGHSSWVASGGLDHKLHLWDLNGGGELLSIDACGGESTAKGSV
YALGAVSSVLASGGPESVVRVWDPKSGKPITKFVGHTDNIRDILITRDGDRIMTASSDQT
IKIWSLTAGRCMHTLTMHNDSVWSLYSSHPQLSVFYSSDRSGLVAKTDTRHCSDVDQGIC
VAALQENDGVVNVVAAGDYIWTATPKSSINRWYDVDTTAEIESPSSRDPADSDAAKPEES
SVRKGRRTKIPYESILLLTSTSTFPKSQVPEGTSEGLPTNGQQRSPDPTLDDDLDLNLPV
YSLPDETIEGQHGLIKHFMLNDRKRTLTQDSAGEVVLWDLLKCKPIQSFGKRHMDDVASE
INTTESIAHWCTIDIRTGRLSVILELNRCFDAEVYADEADLHDYSQIREDQRINLGKWVL
RWLFAPLVDEEIKRDEQYRASAIAKAEELARQTMSSVTAPVDIPSPNAKNLGIQIPYDPS
SLSMRPGNESFGSPTAPGFGIHLATTPGSLTSSMLNTSNNHFGTSPGDVGDHLASPHPDV
VRNSMSDKSDYFSSPRQQGSNAVDATTPGDPTPTALPQSPAEPDKEERKRTGSIFGKKFR
MEFPKKLGRTSSEVKPQVQEEKAEEPEEPSAVKEEKVFDSNLCGFIERIRHEYDEFLAAN
PGQELVSAITPSPDNETPMLDIPPRTAVIIQEESGDTAVASDLYRGSVGSIGQEVDRLEK
SIPMWLAELLLKNQVPAKEPVKIAFMLKPYDDLLPPVSKPDPSVPNGNGVNNSRLNANRM
LRAKKILAYVAERIDPSYSEDPQEGALKPEEYLELYCQKMVCTASTQDDLVSFANLNQLI
PPNMTLATIRAHIWRSSGDMVLYYRANGKKEIPMPGSGREGDQGSQSADATNTPHLSETA
GMANGDGGSAQPSSVHSQSASGSASVSIQNS
NT seq 3156 nt   +upstreamnt  +downstreamnt
atggcacggaaaccaagtcatcagagggtcacttatgtgctccctctgcctgatgcgccg
ggtggtcaccgactcggagtaaatagcttgactgttgatgaagacaattctattttgtat
tccgctggccgcgatggagtgatctgcgcatgggatctcaacctccctctctccgcatcc
aaatcctctccagctctaggcgctcagaagtcaggaccgactaccttcagacatcaagtg
caagcgcacagccattggataaatgacatcgtcttaacgcagaataatacggccctcgtt
tcggcttcatccgataccaccgtgagactctggcgaccacactcggaatccaccgagctg
ccatcacccatcggcaaacatgcagattacgtcaaggcccttgcgacgcccggagggcac
tcaagttgggtggcctcgggaggactcgatcataagcttcacctgtgggatctgaatggt
ggcggcgagcttcttagcatcgatgcctgcggaggcgagagcacggccaagggttctgtt
tatgcgctgggggcagtctcatcggtcctcgccagcggtggcccggagagcgtggtcaga
gtctgggatccgaaatctggaaagccgatcacgaaatttgtgggccacacagacaacatc
cgagacatcttgattactcgagacggagataggatcatgacggcctcgtccgaccaaacg
atcaagatctggtctctcactgcaggaagatgcatgcacaccttgacgatgcacaacgac
agcgtctggtcgctctactccagccatccccagctatccgtcttctattcgagcgaccgt
tctggcttggttgccaagactgacacaaggcactgctcggacgtggatcagggcatttgt
gtcgcagcgttgcaggaaaacgacggcgtcgtgaatgtggtcgctgccggtgactacatc
tggaccgccaccccgaagtccagcatcaaccgctggtacgatgtcgataccactgccgag
attgagtctccctcgtcgagggaccccgcagactctgacgcagctaaacctgaggagtcg
tcggtgcggaaaggtcggcgaacaaagatcccgtacgagtcaatcctactgttgacaagc
acatcgaccttccccaagtcacaagtaccagaaggcacatctgagggtctgccgaccaac
ggacaacagcgctcacccgatccgaccttggacgacgatctggacctcaatctaccagtg
tactccttacccgacgagacgatagaggggcaacatggtttgattaagcatttcatgctg
aacgacagaaagcgcacgcttacgcaagattccgccggtgaggtcgttctttgggatctt
ctgaagtgcaaaccaatacaatctttcggcaagcgccatatggacgacgtcgcatcggag
atcaatactacagagagcatcgctcactggtgcacgatcgacattaggacaggccggtta
tcggtcatcctagagctcaatcgctgctttgacgccgaggtctacgcggacgaggctgac
ctccatgattactcccagatccgggaagatcaaagaataaatctgggaaaatgggttctc
cgttggctttttgctcccctagtggacgaagagatcaagcgagatgagcagtaccgtgcg
tcggccattgcaaaggccgaagagttggccagacagaccatgtcgagcgtcaccgcacca
gtggacattccatcaccgaatgcaaagaatctaggaatccagattccgtatgatccatcg
tctctgtccatgcgccctggaaatgaatcgtttggaagccctacggcgcctggttttgga
atccatctggccaccactccaggttctctgacgtcttccatgctcaatacttccaacaat
cactttggcacctcgccgggtgatgtcggtgaccatctggcgtcccctcatcccgacgtg
gtaaggaattccatgtccgacaaatccgattatttctcgtccccgagacaacaaggctca
aatgcggtggatgcgacgacccctggagatcctactccaactgctctgccccaatcaccc
gccgagcctgataaagaggagaggaagagaactggatcgatctttgggaagaaattccgg
atggaattccccaagaagttgggtaggacgtcctcagaggtcaagcctcaggtgcaggag
gagaaggcagaggagcccgaagaaccctcggcagtcaaagaagagaaagtcttcgatagc
aatctgtgcggtttcatcgagagaattcgtcatgaatacgatgaattcctcgcggcgaac
ccgggacaggagctcgtgtcagccatcacgccaagtcccgataacgagaccccaatgcta
gatatcccacctcgtactgccgttatcattcaggaggaatcgggagataccgctgtggcc
tcggatctctacagaggcagtgttggtagcattggccaggaagttgaccggcttgagaag
tccatacccatgtggctggctgaactactcttaaagaaccaagtccctgccaaggaaccc
gtcaaaatcgcctttatgctgaaaccgtatgacgacctgctgccgcccgtatccaagcca
gatccgtcggttccaaacggtaacggtgtcaacaattctcgtctgaatgcgaaccgtatg
ctgcgtgcgaagaagattctcgcttacgtggcggaaagaatcgacccttcatactccgaa
gacccgcaggaaggcgcactgaagccggaagagtatctggagctctactgccagaagatg
gtgtgtaccgcgtcgacgcaagacgacctcgtatcgtttgctaacttgaaccagctcatc
ccacccaatatgactctggcgaccatccgtgctcatatctggcgatcatcaggcgatatg
gttctatactacagagccaacggaaagaaagagataccaatgcccgggtcaggtagagaa
ggcgaccaaggcagtcagtcggccgacgcaacaaatacgccacatctgtcggagacagca
ggcatggcgaacggggatggaggaagtgctcagcccagcagcgtccattctcagtcagcg
tctggatctgcttcggtgtctatccaaaactcgtga

DBGET integrated database retrieval system