KEGG   Aspergillus fumigatus: AFUA_5G14810Help
Entry
AFUA_5G14810      CDS       T01017                                 

Definition
(RefSeq) pyruvate decarboxylase
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm00010  Glycolysis / Gluconeogenesis
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_5G14810
Enzymes [BR:afm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     AFUA_5G14810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M DXP_synthase_N LSDAT_prok CO_dh
Motif
Other DBs
NCBI-GeneID: 3511487
NCBI-ProteinID: XP_753176
UniProt: Q4WW88
Position
5
AA seq 561 aa AA seqDB search
MAGFTVGDYLAERLSQIGIEHPFVVPGDYNLVLLDKLQAHPKLSEIGCANELNCSLAAEG
YARANGVAACVVTYNVGAFSAFNGTGSAYAENLPLILISGSPNTNDAAQFHQLHHTLGTS
DFTYQLQMAENITCCAVAVGRAQDAPRLIDRAIRGALISKKPAYIEIPTNLSGAPCTRPG
PISAVVDPIQSDRASLLAAIDCAADYLSGKEKPIILAGPKVRRAGAETEILRLAEAMGCA
VVVQPAAKGSFPEDHFQYAGVFWGQVSTLAADCILNWTDAIVCVGVAFTDYSTVGWTALP
IIPLMIAGLDHIFLPGAMFGRVHLRDFLSGLERTVQRNETTLTEYNRIRPDPPMIEASNE
NAPLTRKEMSLQVQTLLTPETTLFVDTGDSWFNGINMRLPHGTKFEIEMQWGHIGWSIPA
SFGYAVAEPQRQVVVMVGDGAFQMTAQEVSQMIRYKTPVIIILVNNQGYTIEVEIHNGIY
NQIKNWDYALLAQAFNSTDGGARGLRVSTGSQLAEAIEKANANRSGPTLIECVIDPDDCT
RELITWGHYVAAANARPPIQL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcttcactgtgggcgattacctggcagaaaggctgtcgcagattggaattgag
catccatttgttgttcccggcgactataatctggtccttctagataagctacaagcccac
ccaaagttatcggagattggctgtgcaaatgagttaaactgctcccttgcagcggagggc
tatgccagggcaaatggtgtcgctgcttgcgtcgtgacctacaacgtaggtgccttctct
gccttcaacggcacaggaagcgcatatgcagagaatctcccgctcattctaatcagcgga
tccccaaacaccaatgatgcggcccagtttcatcagttacaccatactctcggaacgagt
gactttacctatcagcttcagatggcggagaatattacgtgttgtgccgttgctgtgggc
agagcgcaggacgctccgcgtctgattgatcgcgccattcggggtgcgctgatcagtaaa
aagccggcatatatcgagattccgacgaacctctcaggcgctccatgtacacggcctggc
ccgatcagcgcggttgttgatcctatccagagtgaccgagcgtctttgttggcagcaatt
gactgcgccgcggactatctgtctgggaaggaaaaaccgattatacttgctggtccaaaa
gtacgtagagctggtgccgagactgaaatactgcgactcgcggaagcaatgggttgtgcg
gttgtggtgcagccagcagccaaaggatctttcccagaggatcacttccagtacgcaggg
gtcttctggggccaagtgagtactctcgccgcagattgcatcctcaactggacagacgcc
attgtctgcgtgggcgtcgccttcaccgactacagtacagtgggttggacagcattgccc
attattcccctcatgatcgcggggttggaccatatcttcttgcctggagccatgtttgga
cgggttcacctgagagactttctgtctgggctagaaaggacagtccagagaaatgaaacg
acgttgaccgagtataatcgcattcgtccagatcccccaatgatcgaggcatctaacgaa
aacgccccgctcactcgtaaagaaatgtcgctacaggttcaaaccttgcttaccccagag
acaacactatttgtggacacgggagactcgtggttcaacggaatcaatatgagattgccc
catggtaccaagtttgagattgaaatgcaatggggtcatatcggatggtcaataccggca
tcgttcggctatgctgtcgcagaaccccaacgtcaggtggtagtgatggtcggcgacggt
gcattccagatgacagcccaagaggtctcgcagatgattcggtacaagaccccagtgatc
atcatcttggtcaacaaccagggctatacaatcgaggtggaaatccacaatggtatctat
aaccagatcaaaaactgggactatgcgctgctggcccaagcctttaattccactgacggt
ggcgctcgtggccttcgtgtgtcaacaggcagtcaactggctgaggccattgaaaaggcg
aatgccaatcgcagcggaccaaccctaattgaatgtgtaattgatccagatgactgtact
agggagctcattacatggggccattatgttgcggcagcgaacgcgcggcccccgatccag
ctctga

DBGET integrated database retrieval system