KEGG   Aspergillus fumigatus: AFUA_6G00750Help
Entry
AFUA_6G00750      CDS       T01017                                 

Definition
(RefSeq) pyruvate decarboxylase
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm00010  Glycolysis / Gluconeogenesis
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_6G00750
Enzymes [BR:afm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     AFUA_6G00750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 3503697
NCBI-ProteinID: XP_731481
UniProt: Q4W928
Position
6
AA seq 575 aa AA seqDB search
MDSDTLPLAQYLFKRLRQLGVDSIFGVPGDYNLTLLDHVVPSGLKWVGNCNELNAGYAAD
GYSRIKGIGALVTTFGVGELSAVNAIAGAYAERAPVVHIVGTPMRASQESRAMIHHTFID
GEYQRFDRMQEHVTVAQVSLSDHRTAPAEIDRILLQCLLHSRPVRITIPVDMVPVLVPTA
GLASKIEIPPPVRQPQVEEAALTAVLERIYNAKKPMILVDGETRAFGTVNEVNQFVTTTG
WPTFTSGFGKGLVDETLPNVYGVYRPAHKEFVDSCDLVLAFGPHFSNTNTYIFMVRPQDE
TSVLFNPTSVQVNKDIYRDLPAKYFIQQLTQRLDPSKIPVHQHNLVHPSAQVLPEVPPTD
LVTQTAGFWRRLSPFFRSGDIVLGETGTPGYGANDFVLPPQTRLFKPVTWLSIGYMLPAT
LGASYAQRDLIARNEYHNLSAARTILFIGDGSFQMTVQELSTIIHHKLDVIVFLINNDGY
TIERCIHGRNQAYNDVARWRYLKAPELFGADQEGEYASRTWEIRTWADCDAVLKDEQLVN
GKGLRMVEVFMDKFDAPDVLMNLLNAQIARDNAKK
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggactccgacactctacccctcgcgcaatacctctttaaacgtctgcgtcaattgggt
gtagactctatattcggtgtccctggtgattacaacctgactcttctggatcacgttgta
ccctcgggactcaagtgggttggaaactgcaatgaactcaatgcagggtatgctgcggat
gggtactcgcggatcaaaggtatcggtgcgctggtgaccacgtttggagtaggcgaacta
tccgccgtcaatgccatcgcaggcgcctatgcagagagagctccagtcgtgcacattgtg
gggactcccatgcgcgcctcgcaggagtcgcgtgcaatgatccatcatacctttattgat
ggcgaataccagcggttcgaccgcatgcaggaacatgtgaccgttgcgcaagtcagcctg
agtgatcaccgcacagcgcctgccgagatcgacaggatcctgctgcagtgtctgctgcac
agtcgtccggtgcgcattactattcccgtggacatggtccccgtccttgtccccactgcg
gggttggcgtccaagatcgagatcccgcctcccgtacgccagccccaggtggaggaggcg
gccctgacggctgtgctggagagaatctacaacgcgaagaagcccatgattctggtggac
ggggagacaagagcgtttggtacggttaatgaagtgaatcagtttgtcacgacgacgggc
tggccaacatttacgtccggcttcggcaaagggttggttgacgagactctacccaatgtc
tacggagtgtatcggcctgctcacaaagaatttgtcgactcgtgtgacctggtcctggct
ttcggaccacactttagcaacaccaacacctacatcttcatggtgagaccgcaggacgag
acgagcgttctattcaacccaacctccgttcaagtcaataaagacatttaccgtgatctt
cccgccaagtattttattcagcagctcacccagcgactggacccctccaagatccccgtg
caccagcataacctggttcacccctcggcccaggtactccccgaagtgcctcctaccgac
ctcgtgacccagactgcaggcttctggagacgactgtcacccttcttccgctcgggtgat
atcgtcctcggtgaaacaggaacgcccggctacggcgccaatgactttgtgctccccccg
cagacgcgtctcttcaagcccgtcacctggctgtccatcggatacatgcttccggctacc
ctgggagcgagctacgcgcagcgtgatctgattgcgcgaaacgagtaccacaacctctcc
gccgcccggacaatcctcttcatcggcgacggcagcttccaaatgaccgtccaagagctg
agcacgatcatccaccacaaactcgacgtcattgtcttcttgatcaataatgacggctat
acaatcgagcggtgcatccatggccggaaccaggcgtacaacgacgtcgcccggtggcgg
tatctcaaggcccccgagctattcggcgcggatcaagagggcgagtacgcatcgcggaca
tgggagattcgcacgtgggcggactgtgacgccgtgctgaaggatgaacagctggtgaat
ggcaagggactgcgcatggtggaggtgttcatggacaagtttgacgcgccggatgtgttg
atgaatctgctgaatgcgcagattgcgagggacaatgcgaagaaataa

DBGET integrated database retrieval system