KEGG   Aspergillus fumigatus: AFUA_6G02510
Entry
AFUA_6G02510      CDS       T01017                                 

Definition
(RefSeq) chitin biosynthesis protein (Chs5)
  KO
K19877  chitin biosynthesis protein CHS5
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:afm04131]
    AFUA_6G02510
Membrane trafficking [BR:afm04131]
 Exocytosis
  Others
   Exomer complex
    AFUA_6G02510
SSDB
Motif
Pfam: fn3_2 CHS5_N PTCB-BRCT BRCT BRCT_2 fn3 DUF3006 PPP4R2
Other DBs
NCBI-GeneID: 3505078
NCBI-ProteinID: XP_747827
UniProt: Q4WCU9
Position
6
AA seq 457 aa
MLVSLTVGKVDAGVAVLLTQDNRLDSTLLVRTVGRFTAANLGNLQIEFPSVLLPNSITSG
SIVDITVSRNHAAEAASTSAFQALQKRILNTYGVKTPAPPVLRLRNATQTSLVLEWDPID
LATASLKSLSLYRNGSKAGSIPRPLETRSTKISGLAIDTEYSFHLVLRTTAGTYQSEKLT
CRTHKMTDLSGITVTPGVLPEQQKEALAAALERIGGKMIDTVRIDTTHFVCTEGRGPLWE
KAVEMNIPVVVPEWVDACEAEGTIVGVRGYYLNADPKARQLGPIHASTHQHTRSSVSMAT
NAPSQSQSQSQSQPQSQSQSRLSLQPQPTHQRELSVGDPPVTPFPGADMSGQPRADEREV
SSDEEDLPPPPPPKDDAAGAEPAVNGKPESTSPEGVVSSGDKEERSESDEKHDEKDEDET
AHEQAEEKQEQEEPTSNDSDAKGKGKEGEGDFSEISL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgttggtctccttgacagtaggcaaggtagacgcaggagttgctgtgctcttgacgcag
gataaccgactcgattctaccttactagtaaggactgttggacgattcacggctgctaat
ctcggcaatctacagatcgaattcccctccgtccttctcccgaacagcatcacatctggc
agcattgtcgatatcacagtatcgcgcaaccatgccgctgaagctgctagcacttcagcc
ttccaggcgctacagaagcggattctcaacacctacggcgtgaagacccctgcccctcct
gtcctccggctccgcaacgcaacacaaacctccctagtcctagaatgggatccaatcgac
ctggccactgcgtcgctcaagtcgctttctctctaccgcaatggctcgaaagctggttcg
ataccaaggccgctcgagacacggagcaccaagattagcggcctcgccatcgacacggaa
tattccttccacctcgtcctgcgcacaacagccggcacataccaatcggagaaactgaca
tgtcggacacacaagatgaccgatttgtccggtatcacggtgacccctggcgtcctcccc
gaacagcagaaagaggcgctcgccgcggctttggaacgtattggcggcaagatgatcgac
acagtgcgcatcgataccactcactttgtatgtacagaaggcagaggcccgctgtgggag
aaagcggtggagatgaacattcccgtcgtggttccggagtgggtggatgcctgtgaagcc
gagggcaccatcgtcggagtccggggctactacctgaatgcagaccccaaggccagacag
ctcggccccatccatgcctcgacacatcaacataccagatcctccgtgtcgatggcaacc
aatgcgccatctcagtctcagtctcagtctcaatcccaaccccaatcacagtctcagagt
agactgagcctccagcctcaacctacgcaccagagggaattgagcgtcggggaccccccc
gtgactcccttccccggtgcagatatgagtggccagcctcgagcggatgagagagaggtc
tcatcggatgaagaggacttgccgccgccccctcctccgaaggatgatgctgcaggtgct
gaacccgctgtgaacggcaaacctgagtcgacaagcccggagggagttgtctcttctgga
gacaaggaggaacggagtgaaagtgacgagaaacatgacgaaaaggatgaagatgaaacc
gcacacgaacaggccgaagaaaagcaggaacaggaagaaccgacatcaaacgacagtgat
gccaagggtaaggggaaggaaggtgagggggactttagcgagatttctctgtga

DBGET integrated database retrieval system