KEGG   Aspergillus fumigatus: AFUA_6G05000Help
Entry
AFUA_6G05000      CDS       T01017                                 

Definition
(RefSeq) Glycosyl hydrolases family 32 superfamily
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
afm  Aspergillus fumigatus
Pathway
afm00052  Galactose metabolism
afm00500  Starch and sucrose metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AFUA_6G05000
   00500 Starch and sucrose metabolism
    AFUA_6G05000
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AFUA_6G05000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR
Motif
Other DBs
NCBI-GeneID: 3504998
NCBI-ProteinID: XP_747578
UniProt: Q4WDJ8
Position
6
AA seq 628 aa AA seqDB search
MHILPGSQHAAELDNSGTLIHSVHCDPEQKAKNIPQSTGIAQASSEWRPSYHLAAPRGWM
NDPCGLGYDPTTGLYHLSFQWNPHGNDWGNISWGHATSSDLVSWQISPEPCLTPSAEYDR
CGVFTGCFRSHGPDGKPGVLTYVYTSVNHLPLHYTLPYVKGSESLSIAVSRDHGKTWQRI
DSNPIHPGAPAGLEVTGWRDPYLNCWPSLRAQRQGGVASPDLYGFISGGIAKESPTVFVY
VVNPDNLTEWTYIGPLLHVGLNYRPSRWSGDLGVNWEVANFFTLTDGGVSRDIVIFGAEG
CLSCEVGSKRVPRSLLWMCINVRPGLQAQSSGEPLADYSFSGIFDHGCCYAANSFWDPVT
EEYVVYCWITEEDLPDRLRHRQGWSGIMSLPRLVRLVTLHNVKRAHQSKLESITSVEIER
HSQGTQVRTLSVRPDPRLNILRTSARELHLSNVQLGSVAHQPPAFLPLRTARWEMTATFV
IGTHCAAVGLEIGHSPEDFHQRTTLSWIPYDETFTIERPPLHDAGINHVPETAPHTLFTF
CNNEGEEVTEPLQIHAYFDASVLEVFVNSRTVISTRIYTPHAQVCTGLKFFASATESQPK
PSTSAPAAVLVRADIWDGLSVIRDEIKH
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcatatccttccaggatcccaacatgcggcagagttggacaacagtggaactctaata
cactctgtccattgcgatccagaacagaaagccaagaatatcccgcaatcgacgggtata
gctcaagcgagctctgaatggcgaccgtcataccatcttgctgcgccccgggggtggatg
aatgacccctgtgggcttgggtatgacccgacgactggactgtaccacctgtccttccaa
tggaacccgcatgggaatgactggggcaacatctcctggggccatgccacctccagcgat
ctagtgtcctggcaaatatcccccgaaccatgtctcacgccgtctgcggagtatgatcga
tgcggcgtgttcactggctgcttccgttctcatggtccagatggcaagccaggtgtacta
acgtatgtatacacatccgtaaatcaccttccactccactatactctgccgtatgtcaag
ggcagtgaatcgctcagtatagctgtctcccgtgaccatggcaagacctggcaacgaatc
gacagtaatccgattcaccccggcgcccctgcaggactcgaggtgacaggctggagagac
ccttatctgaactgctggccctcgttgcgggcccagcgacagggtggagtggcctccccg
gatctgtatggatttatctccgggggcatcgctaaagagtccccaacagtctttgtatat
gtcgtcaatcccgacaatctgactgagtggacatatatcgggcctttgcttcatgttggc
ttgaattatcgaccctctcgatggtcgggggatctcggcgtcaactgggaagttgccaac
ttctttacgttgacagatggcggcgtctcccgggatatcgtgatcttcggcgcagaggga
tgcttgtcttgcgaggttggatcaaagagagtaccgcgctctttgctctggatgtgcatt
aatgtccgacctggactgcaggcgcaaagcagtggcgagcctctcgcagattattcattc
tcggggatcttcgatcacgggtgctgctacgctgcaaactctttctgggacccggtcacg
gaggagtatgtcgtatactgctggattacagaggaggatttaccagatcgcctgcgccat
cgacaaggctggagtggcatcatgtctctaccgcgactagtaaggctggtgactcttcac
aatgtcaagcgagcccaccagtcaaagctggaatccattacgtctgtcgaaatagagcgc
cattcgcaaggtactcaggtccgaaccttgagtgtccggcctgaccccaggctcaacata
cttcgaacatcggctcgagagctgcatttatccaatgtacaactgggctctgtggcccat
cagcccccggcattcttgcccctgcgcactgctaggtgggaaatgaccgcgactttcgtg
attgggacgcattgcgcggcagtaggattggaaatcggccatagccctgaagatttccac
cagcgcaccaccctatcatggataccatacgacgagacgttcacaatcgaacggcctccg
cttcacgatgccggtatcaaccatgtccccgagaccgctccgcatactctcttcaccttc
tgcaacaatgaaggcgaggaggtgacggaaccgcttcagatccacgcctatttcgatgca
agtgtgctagaagtgtttgtgaatagcaggacagtcatctccacacgcatctatacaccc
cacgcgcaggtctgcacggggctgaaattcttcgcctcggcaaccgaaagtcagccgaaa
ccatcaacatctgctcctgctgctgtgctggtgagagcagatatttgggatggactgagt
gtgattcgtgatgaaattaagcattag

DBGET integrated database retrieval system