KEGG   Aspergillus fumigatus: AFUA_6G08870Help
Entry
AFUA_6G08870      CDS       T01017                                 

Definition
(RefSeq) nicotinamide mononucleotide adenylyl transferase
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
afm  Aspergillus fumigatus
Pathway
afm00760  Nicotinate and nicotinamide metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AFUA_6G08870
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     AFUA_6G08870
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     AFUA_6G08870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 3508063
NCBI-ProteinID: XP_750776
UniProt: Q4WMS6
Position
6
AA seq 288 aa AA seqDB search
MTDMVGGQSDDVHQVPPPLPPAPMENYTFPEHRLKRKMDDPEKTPLLLVACGSFSPITYL
HLRMFEMAADYVKFSTDFELIGGYLSPVSDAYRKAGLASAEHRVAMCQLAVDQTSNWLMV
DTWEPMQKEYQPTAVVLDHFDYEINVVREGIDAGNGTRKPVRVALLAGADLIHTMSTPGV
WSEKDLDHILGKYGSFIVERSGTDIDEALAALQPWKDNIYVIQQLIQNDVSSTKIRLFLR
REMSVRYLIPVPVIHYIEQHHLYEDDSTTTASSSADKGKEPSQPGKSG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacagacatggtcggaggacagagcgacgatgtccaccaggtgccgcctcctcttcca
ccggcccctatggagaactacacctttcctgaacatcgtttgaagcgcaagatggacgac
ccggagaagacccctctgctcctcgtggcttgcggttccttctcccccatcacctacctg
catcttcgcatgtttgaaatggcggccgattacgttaaattcagcacggactttgagctc
atcggtggatatctctcacccgtttcagacgcgtatcggaaggctggtctagccagtgcg
gaacatagggttgctatgtgccaacttgcggttgatcagacatcgaattggctgatggtc
gatacatgggagccgatgcagaaagagtatcagccaactgccgttgtgcttgatcatttt
gactatgagatcaatgttgtacgagagggtattgatgctggaaatggtacccggaagccc
gtccgggtggccttgcttgcaggcgcagatctgatccacaccatgtcaactcccggagta
tggagtgagaaggatctggaccatattttggggaaatacggctctttcatcgtggaacgc
agcggcaccgatatcgacgaggctttagctgcgttgcaaccatggaaggacaacatctac
gtgatccaacaactcatccaaaacgatgtcagcagcaccaagatccggcttttcttgcga
cgcgagatgagcgtgcgctatctcattcccgttccagtcatccactacattgaacagcac
catctatacgaagatgacagcacgacgaccgcctcctcgtcagccgataaaggcaaggaa
ccttcacagccagggaagtcaggctga

DBGET integrated database retrieval system