KEGG   Aspergillus fumigatus: AFUA_6G09250Help
Entry
AFUA_6G09250      CDS       T01017                                 

Definition
(RefSeq) exo-beta-1,3-glucanase
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
afm  Aspergillus fumigatus
Pathway
afm00500  Starch and sucrose metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFUA_6G09250
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     AFUA_6G09250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cellulase EphA2_TM SLC3A2_N SR-25
Motif
Other DBs
NCBI-GeneID: 3508103
NCBI-ProteinID: XP_750812
UniProt: Q4WMP0
Position
6
AA seq 833 aa AA seqDB search
MPTHSRSRDRYGGRDSDREARYDYDYARRRYATDDDDDYDDDELEHDLTERRYRRDGYRP
PRESRARGYYERDAEGAADEELLGNERDPGPRASRSYGDDYDARRREHSRAREAPRRSER
HRDRDREGRSRRRAYEDDGRHRTRDGRRDRGRESDGEARRSRRREAGRETAARKHRSSDS
TNSASHLLSADALAKLGAQYEKEERRKREIAKDAAKAERKRQKKLAVVGEETRALRDPPG
ESHRDRTKARVASGAYLEEGRSPEMRVRHRGGGGPAMEARWRKEGSWGGTMDDSGGGRPF
WKRKRWIGLGALIIILVIVIPVAVVVSKKHDNKSDPADSQGTSPGKSNLDGLSHDSIPAY
AQGTYLDPWTWYDTTDFNVTFTNETVGGLSIMGLNSTWDDSARPNDNVPPLNEPFPYGSQ
PIRGVNLGGWLSIEPFIVPSLFDSYSSVSGIIDEWTLSKRLGSSAASTLEKHYATFITEQ
DFADIRDAGLDHVRIQYSYWAVATYDDDPYVAKISWRYLLRAIEYCRKYGLRVNLDPHGI
PGSQNGWNHSGREGVIGWLNGTDGELNRNRSLAVHDSVSKFFAQDRYKNIVTIYGLVNEP
LMLSLSIEDVLDWTTEATKLVQKNGITAYVALHDGFLNLSKWKSMLKNRPDKMLLDTHQY
TIFNTGQIGLNHTAKVNLICNDWYNMIKEINSTSTGWGPTICGEWSQADTDCAKYLNNVG
RGTRWEGTFSLTDSTQYCPTADTGPPCSCANANADVSKYSADYKKFLQTYAEAQMSAFET
GQGWFYWTWRTESAAQWSYRTAWKNGFMPAKAYAPSFRCGDAVPDFGDLPEYY
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgccaactcactcccgaagtcgggaccgctatggcggtcgcgacagcgaccgggaagca
cggtatgactacgactatgcgcgacggcgctacgcaactgatgacgacgacgattatgac
gatgacgaactcgagcacgacctcaccgagcgccgatacagacgggacgggtaccgtccc
ccgcgtgagtcgcgggcacgcgggtactacgaacgcgatgcggagggggcggccgatgag
gaattgctaggtaatgagcgagacccggggccgcgagcgagcagatcttacggtgatgac
tatgatgcgcgacgaagggaacactcgcgggcgagggaggctccaaggagaagcgagcgg
catcgcgacagggatcgagagggccggagcaggcgcagggcgtatgaagatgatgggcga
catcggacgagagacggccgccgggacagaggtcgcgagtcggatggtgaggcgcggaga
tctagacgaagggaagcggggcgcgagacagccgcgaggaagcatcggagcagtgactcg
accaatagtgcgtcgcatttgctgagcgcagatgcgttggctaagcttggggctcaatat
gagaaggaggagcgtcggaaacgcgagatcgccaaggacgccgccaaagcggagagaaaa
cgtcagaagaagctagcagtcgtgggagaagaaacccgcgccttacgtgatccgcctggc
gagtcacacagagatcggacgaaggcgagggtcgcatctggggcgtaccttgaagaaggc
cgcagccccgagatgcgagtccgccatcgtggaggtggtggcccagcaatggaagctaga
tggcggaaagaaggtagctggggaggcactatggacgattcaggcggcggaaggccattt
tggaaacgaaagagatggattggcctgggcgctttgatcatcatactggtcattgtgatt
cccgtcgccgtcgtcgtgtctaagaaacatgacaacaagtctgacccggcagattcacaa
ggaacctctcctggtaaatcgaatctggacgggttgagtcatgacagcattccagcttac
gctcagggaacatatctggacccttggacatggtatgatacgactgacttcaatgtcact
ttcactaatgaaacggttggtggtttgtctatcatgggcttgaactcgacctgggacgac
tcggctagaccgaacgacaatgttcctcctttgaacgaaccgttcccgtatggatcacag
ccaatccgcggcgttaacctaggaggctggctgtcaatcgagccgttcattgttccttca
ttgttcgactcttactcctcggtctcagggatcattgatgaatggacactgtccaagaga
ctcggcagctccgcagccagcacgcttgagaaacactatgctacattcatcactgaacaa
gattttgcagacatccgagacgcaggtctcgaccacgtccgcattcaatattcctactgg
gcggtagcaacgtacgacgacgacccttatgtggcgaagatttcgtggcgatatctcctc
cgagcaatcgagtactgcagaaaatacgggctcagagtcaatctcgacccgcatgggatt
cctggaagtcagaatggctggaatcacagcggtcgtgagggtgtcattggctggctcaat
gggacagatggcgagctcaaccgcaatcggtctctggctgttcacgacagcgtgtccaag
ttcttcgcgcaggaccgatacaagaacatcgtcacgatctacgggctcgtgaatgagcca
ctgatgctctcgctctcaatcgaggatgtccttgattggacaaccgaggctacgaagctc
gtgcagaagaacggcatcactgcgtacgttgctttgcacgatggcttcctgaacctgagt
aaatggaagagcatgctcaagaaccgtcccgacaagatgttactggatacgcaccaatac
accattttcaatacagggcaaataggcctcaaccataccgcgaaagtcaacctaatctgc
aacgactggtacaacatgatcaaagagatcaactctacaagcacaggctggggcccaacg
atctgcggcgaatggtcccaagccgatacagactgcgccaaatacctcaacaacgtcggt
cgcggcacccgttgggaaggaaccttctccctcacagactcaacccaatactgtccaacc
gccgacactgggcctccttgcagctgcgccaacgccaacgcagatgtcagcaagtactca
gccgactacaagaagttcctgcagacatacgcagaggcgcagatgtctgcgttcgagacc
ggacagggttggttctactggacctggcgcacagagtctgcggcacagtggagctacagg
accgcttggaagaatggcttcatgccagccaaggcatatgcgccatcattcaggtgcgga
gatgcagtgcctgatttcggagacttgccggagtactattga

DBGET integrated database retrieval system