KEGG   Aspergillus fumigatus: AFUA_6G11020
Entry
AFUA_6G11020      CDS       T01017                                 

Definition
(RefSeq) 3-hydroxyisobutyrate dehydrogenase
  KO
K23146  3-hydroxyisobutyrate/3-hydroxypropionate dehydrogenase [EC:1.1.1.31 1.1.1.59]
Organism
afm  Aspergillus fumigatus
Pathway
afm00280  Valine, leucine and isoleucine degradation
afm00410  beta-Alanine metabolism
afm00640  Propanoate metabolism
afm01100  Metabolic pathways
afm01200  Carbon metabolism
Module
afm_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AFUA_6G11020
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFUA_6G11020
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFUA_6G11020
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     AFUA_6G11020
    1.1.1.59  3-hydroxypropionate dehydrogenase
     AFUA_6G11020
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored OCD_Mu_crystall DUF1318 UDPG_MGDP_dh DUF5678 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 3508293
NCBI-ProteinID: XP_750988
UniProt: E9R5K9
Position
6
AA seq 365 aa
MSLTPTVSLRIRGFSVPKSLLSSLSSVPQLQRSQARTFSTTLQRDATWGFIGLGQMGYLM
AKNLRAKIPATDTLLVRDVNENATTRFVEETKEAAKSSGAADGTMKVEVAQSAREVAEQS
TVMITSLPEPEHVKDVFHSILKHGDLPALEEERLFIDTSTIDPASSKEIANAIHSTRTGH
FVDAPMSGGVVGARAGTLSFMFGASSQSGQLIERVRAVLMLMGKKAWHLGPPGAGVSGKL
ANNYILAINNIATAEAMNLGTRWGLDPKSLADMINTSTGRCWPMEVNNPVPGVVETAPAS
RGYEGGFGVGLMKKDLRLAITAAKESGTPLALAETAREVYNSVEQEYRGKDFSVVYKWLQ
DRSEQ
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagtctcacacccactgtgtcccttcgaatccggggattttctgtccccaaatcgttg
ctgtcttcattgtcatcggtgccacagctccagcggtctcaggccaggacgttctctacc
acgctgcaacgtgatgcaacatggggattcattggcttaggccaaatgggctatttgatg
gcgaagaacctacgtgccaaaattccagctactgacacgcttcttgtgcgtgacgtgaac
gagaatgcgacgacgaggtttgttgaggagacaaaggaggcagcgaaaagcagtggtgct
gcagatggcacaatgaaggttgaggtcgcccagagtgctcgagaagttgcggagcagtcg
acagtcatgataaccagtctaccggagccagaacacgttaaggatgttttccattcaatc
ttgaagcatggcgacctacccgctctggaagaagagcgcctgttcattgatacatcaacc
attgatcccgcctcgtccaaggagattgcaaacgcaatccactcaacacggacagggcac
ttcgtcgacgctccaatgtcaggaggagtagtaggtgctcgtgcaggtacattgagcttt
atgttcggagcatcgtctcaaagcggccagctcatcgaacgagtcagagcggttctcatg
cttatgggaaagaaggcctggcatctgggacctcccggagcaggcgtatcgggtaagctt
gccaacaactacattttggctataaacaacatcgcaacagctgaggccatgaatcttgga
actcgctggggcctggatcccaaatctctcgcagacatgatcaatacctctactggccgc
tgttggccaatggaagtcaacaatcctgttccaggcgttgtggagactgctccagcatcg
cgtggatatgagggcggctttggagtcggtttgatgaaaaaggacctcaggttagcaatc
acggctgcgaaggagtctggcactcccctggccctagctgaaactgctcgtgaggtatac
aattctgtcgagcaggagtaccgaggcaaggacttctctgttgtgtacaagtggctgcaa
gacaggtcagagcagtag

DBGET integrated database retrieval system