KEGG   Aspergillus fumigatus: AFUA_6G11430Help
Entry
AFUA_6G11430      CDS       T01017                                 

Definition
(RefSeq) aldehyde dehydrogenase AldA
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
afm  Aspergillus fumigatus
Pathway
afm00010  Glycolysis / Gluconeogenesis
afm00053  Ascorbate and aldarate metabolism
afm00071  Fatty acid degradation
afm00280  Valine, leucine and isoleucine degradation
afm00310  Lysine degradation
afm00330  Arginine and proline metabolism
afm00340  Histidine metabolism
afm00380  Tryptophan metabolism
afm00410  beta-Alanine metabolism
afm00561  Glycerolipid metabolism
afm00620  Pyruvate metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_6G11430
   00053 Ascorbate and aldarate metabolism
    AFUA_6G11430
   00620 Pyruvate metabolism
    AFUA_6G11430
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AFUA_6G11430
   00561 Glycerolipid metabolism
    AFUA_6G11430
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFUA_6G11430
   00310 Lysine degradation
    AFUA_6G11430
   00330 Arginine and proline metabolism
    AFUA_6G11430
   00340 Histidine metabolism
    AFUA_6G11430
   00380 Tryptophan metabolism
    AFUA_6G11430
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFUA_6G11430
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AFUA_6G11430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 3508331
NCBI-ProteinID: XP_751026
UniProt: Q4WM26
Position
6
AA seq 559 aa AA seqDB search
MASPHPPSPIRLCPSSLPAAAPYSLPWLTLLPIIRKCPPFLCLDSVIPPPPPPYQSPYPP
PTMSDLYATIETPQGKYEQPLGLFINNEFVKGVEGKTFETINPATEQPIVAVHEATEKDV
DIAVAAARKAFEGPWRQVTPSDRGRMLNKLADLMEREIETLAAIEALDNGKAFSIAKLDM
AGAAGCIRYYAGWADKIHGQTIDVNPETLTYTRHEPIGVCGQIIPWNFPMLMWSWKIGPA
VATGNTVVLKTAEQTPLSALYAAKLIKEAGFPPGVINIISGFGRTAGAAIASHMDVDKVA
FTGSTLVGRNILQAAAKSNLKKVTLELGGKSPNIVFEDADIENALKWASFGIYFNHGQCC
CAGSRILVQESIYEEFLARFKERSEQNKVGDPFDPQTFQGPQVSQLQFDRIMGYIQDGKQ
AGARVVTGGERLGDKGYFIKPTIFADVNGDMKIVQEEIFGPVCTVQKFKTEEEAIKLANS
TNYGLASAVHTKNVNTAIRVSNAIKAGSVWVNNYNMIYPQAPFGGYKESGLGRELGSYAL
ENYTQVKTVHIRTGDCPFP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccccatcccccatcccccatccgcctttgcccctcctccttaccggcagca
gctccatacagcttgccgtggttgactctcttacctataataaggaagtgtcctcccttt
ctctgtcttgactctgtgataccccctcccccccctccctatcagtcgccatatccaccc
cccaccatgtctgacctttacgccactatcgagactccccagggcaaatatgagcagccc
ttgggtttgttcatcaacaatgagtttgtgaagggtgttgaaggcaagaccttcgagacc
atcaaccccgccaccgagcagcccattgttgctgtccacgaagccactgagaaggatgtc
gacattgccgttgccgctgctcgcaaggcattcgagggtccctggagacaggttactccc
tcggaccgtggccgtatgcttaacaagctggccgatctgatggagcgcgaaatcgagacc
ctcgctgccattgaggcccttgacaacggcaaggccttcagcatcgccaagctggacatg
gccggtgctgctggctgcattcgctactatgctggctgggctgacaagatccacggccag
accattgacgtcaaccctgagacactcacctacactcgccacgaacccatcggtgtctgc
ggtcagatcattccttggaacttccccatgctgatgtggtcgtggaagatcggtcctgcc
gtcgccactggtaacactgttgtcctcaagaccgctgagcagactcctctgtccgccctc
tatgccgccaagttgatcaaggaagctggcttcccccctggcgtcatcaacattatttcc
ggcttcggacgtactgctggagctgctattgctagccatatggacgtcgacaaggttgct
ttcactggttccacccttgtcggacgtaacatccttcaggctgccgcaaagagcaacctc
aagaaggttactctcgagctcggtggaaagtcccccaacattgtctttgaggatgcagat
attgagaacgctttgaaatgggcgtcatttggaatttatttcaaccatggccagtgctgc
tgcgcgggatctcgtatccttgtccaggagtcgatctacgaggagttcctggctcgattc
aaggagcggtcagaacagaacaaagtcggcgatcccttcgatccccagacgttccaagga
cctcaggtttcgcagctgcagttcgatcgcatcatgggctacatccaagacggaaagcag
gcgggtgcaagagttgttactggcggagaacgccttggtgacaagggatatttcattaaa
cccactatctttgcggatgtcaacggcgatatgaagattgttcaagaggagatcttcggc
cctgtttgcacagtgcagaagttcaagaccgaggaggaggccatcaagcttgctaacagc
accaactatggtcttgcctctgctgtccacaccaagaacgtcaataccgcaattcgtgta
tcaaacgccatcaaggctggaagcgtctgggtcaacaattacaatatgatctatccccag
gcaccattcggtggctacaaggaatcgggtcttggccgtgaactcggctcttatgctctt
gagaactatactcaggtcaagacagtacacatccggacaggcgattgcccgttcccctga

DBGET integrated database retrieval system