KEGG   Aspergillus fumigatus: AFUA_6G12770
Entry
AFUA_6G12770      CDS       T01017                                 

Definition
(RefSeq) proteasome regulatory particle subunit (RpnI)
  KO
K03039  26S proteasome regulatory subunit N9
Organism
afm  Aspergillus fumigatus
Pathway
afm03050  Proteasome
Brite
KEGG Orthology (KO) [BR:afm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    AFUA_6G12770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:afm03051]
    AFUA_6G12770
Proteasome [BR:afm03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     AFUA_6G12770
SSDB
Motif
Pfam: Rpn9_C PCI
Other DBs
NCBI-GeneID: 3508462
NCBI-ProteinID: XP_751155
UniProt: Q4WLP7
Position
6
AA seq 405 aa
MSSLHYGGAETPPKLLPSLLHFSTMENQKISDFLADQLQQAPEQSQAFFLSFEDFWERKL
WHQLTNALVEFFQLPESAPQRLPIFKTFVLSFADKINQLKFVSLGLMASTECADDQERLS
FLTSLADKVNKPDTQEAYVYALAEVANVKQRLQDLDGAQKDLEVCQKVLDSFDSVETVVH
ASFYKVNADYYHAKQEFAAYYKNALLYLACINLDDLSESERVSRAYSLSVAALVSDTIYN
FGELLLHPILDSLTETPHSWLRDLLFAFNRGDLTAYDVLAGNISKNKLLEQHRIFLYQKI
SLSALTEMVFRRPPHDRNLTFASISSETKVKPEEIEHLVMKALSLGLLKGAIDQVAQVAQ
IHWVQPKVLDMKQIEGMRNRLKDWDAGVNQLGHWIEGVGKDVWAA
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcatctctccactacggcggcgcagagacaccgcccaagctcctaccatctctcctt
cacttctccacaatggagaaccagaagatctccgatttcctggcagaccagctgcaacaa
gctccagagcagagccaggcctttttcctcagctttgaagacttctgggaacggaaacta
tggcatcaattgaccaacgctctggtggagtttttccagttacctgaaagcgctcctcag
cggttacccatattcaagacgtttgttctgagcttcgccgacaagatcaatcagctgaag
ttcgtctcgttgggtttgatggcatcaacggaatgcgcggatgaccaagagcgactttcc
ttccttacatcgcttgccgacaaagtgaacaaacccgacacacaagaagcttacgtgtat
gcccttgcggaagttgcaaacgtgaagcagcgactacaggacttggatggagcgcaaaaa
gatctggaagtatgccagaaggttttggactcgttcgattccgtcgagacggtggtgcac
gcttccttttacaaggtcaacgcagattactaccacgccaaacaagaattcgccgcctat
tacaaaaacgcccttctttacctggcctgcatcaacctggacgatcttagcgagtcagaa
cgtgtctcccgcgcatacagcctgagtgttgccgcgctcgtctctgacacgatttacaac
tttggtgaactcctactgcacccgatcctggactcgctcaccgagacgccgcacagctgg
ctgcgcgacctcctgtttgccttcaaccgcggcgaccttactgcgtacgatgtcctggcc
ggcaacatctccaagaacaagctgcttgagcagcatcgcattttcctctaccagaagatc
tccctgtcagccctcacagaaatggtcttccgtcgacccccgcacgaccgcaacctcaca
ttcgcgtcgatctcctccgagacgaaggtcaagcccgaggagatcgagcacctggtcatg
aaggctctgtccctgggtcttctgaagggtgctattgatcaggttgcgcaggtcgcgcag
attcactgggtgcagcccaaggtcttggatatgaagcagattgaaggcatgcgcaataga
ctcaaggattgggatgctggtgtgaatcagctgggtcactggatcgagggagttggtaag
gacgtgtgggctgcttag

DBGET integrated database retrieval system