KEGG   Aspergillus fumigatus: AFUA_6G13520Help
Entry
AFUA_6G13520      CDS       T01017                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
afm  Aspergillus fumigatus
Pathway
afm00260  Glycine, serine and threonine metabolism
afm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
afm01230  Biosynthesis of amino acids
Module
afm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFUA_6G13520
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AFUA_6G13520
Enzymes [BR:afm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AFUA_6G13520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 3508541
NCBI-ProteinID: XP_751228
UniProt: Q4WLH4
Position
6
AA seq 460 aa AA seqDB search
MIIPATFKPSLTRIRSKRRSKGIKNGDTHSICPACLYHLSIIQGRTTIPSTLLLHHVQLD
TPSESNCLINGETLKECPVWETSPLPCLPILLSPTRFGTFGGRFAPESHMDALQELTLAF
DRFSSDYSFWKEFVSFPGIRPSPLRFAENLTRIAGGANIWLKREDLNQHGSHNIRSIVGQ
ALLARRLGKAEVVMECGSARHGIVCAATCARLSMECTILMGSRDATDQKDSVDMIRKLGA
TVLTADMGASSGRGTLRAAVNEALRYSVAHLSTAYHIMSGPIGPHPLPTITRTFQSILGE
EIKTQFGGASGDRLPDALVSPVGPGSAAVGMFYPFIEHPSVKLLGVEAADAAPLSHDEIG
VLHGCRTYLLQDEHGQILDSSSISPDLDFPSVGPELAHWKETARVEYVTATDTEALRGLD
ILRSQEGIVPGAMTGYAVERTIRLARELGPGKDVVLLVAG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgattattccggccactttcaagccttctctgacaagaatcagaagcaagagacgcagc
aaggggatcaagaatggagatactcactcgatatgtccagcatgtctctatcatctcagc
attatacaagggaggacgaccatcccttccacgctacttctccatcatgtacagctcgac
acaccttcggagtcaaattgtctgatcaacggagagacacttaaggaatgtccagtatgg
gaaaccagccctctcccctgcctgccaatcctcttgtctccaaccaggttcggcactttt
ggtggccggtttgctcccgagtcccatatggacgccttgcaggagctcacattggcgttc
gaccgtttcagctcagactacagcttctggaaagagttcgtaagcttccccggtatccgt
cctagcccgcttcggttcgcagaaaacctcacgcgcatcgctggcggcgcgaatatctgg
ctcaagcgggaggatctaaaccaacatggtagtcacaatatccgcagcattgtcggtcag
gccctgctcgcacggcggctaggaaaggccgaagtcgtgatggagtgcggctcagctagg
cacggtatcgtctgcgcggcgacctgcgcacgcttgagtatggagtgcaccatcctcatg
gggagccgggacgcaaccgaccagaaggacagcgtggacatgatcaggaaactcggcgcg
acagtcctcaccgcagacatgggggcgtcgtcgggtcgtgggaccctccgagctgcagtc
aacgaggcccttcggtattcagtcgcccatctcagcaccgcataccacatcatgagcggt
ccaatcggtccccacccgcttccaacaatcacacgcaccttccaatcaattctcggcgag
gagatcaaaacgcaattcggcggcgccagcggtgaccggcttccagacgccctcgtctcc
cccgtcggaccaggcagtgcagccgtcggcatgttctacccgttcattgagcatccgtcg
gtgaaactgctcggcgttgaggcggcagacgcagctcccctatcccacgatgaaattggc
gtcctgcatggatgccgcacctatctcctccaggacgagcatggccagatcctcgattcg
agctcgatatcccccgatctggactttcccagcgttggccctgaactggcgcactggaag
gagacggccagggtggaatatgttactgccacggacacagaagccttacggggtctggac
attcttcggagccaggaggggattgtcccgggagcgatgacggggtatgcggttgagagg
acaattcggcttgcaagggaactagggccggggaaggatgttgtcttgcttgtggcggga
tga

DBGET integrated database retrieval system