KEGG   Aspergillus fumigatus: AFUA_7G01830Help
Entry
AFUA_7G01830      CDS       T01017                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase Ugp1, putative
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
afm  Aspergillus fumigatus
Pathway
afm00040  Pentose and glucuronate interconversions
afm00052  Galactose metabolism
afm00500  Starch and sucrose metabolism
afm00520  Amino sugar and nucleotide sugar metabolism
afm01100  Metabolic pathways
afm01130  Biosynthesis of antibiotics
Module
afm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AFUA_7G01830
   00052 Galactose metabolism
    AFUA_7G01830
   00500 Starch and sucrose metabolism
    AFUA_7G01830
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_7G01830
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AFUA_7G01830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP PilO
Motif
Other DBs
NCBI-GeneID: 3504227
NCBI-ProteinID: XP_746749
UniProt: Q4WAM5
Position
7
AA seq 511 aa AA seqDB search
MPLFSSSSSSSSSANKLTQFPRAQAFENASTSVAASQMRNALNALAETVPDPEEKKRFEA
EMDNFFALFRRFLNDKAKGNVVNWDRINPPAPNQVVDYNDLGAEASVEFLNKLAVVKLNG
GLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEHLNRTYNVNVPFVLMNSFNTDQDTQSII
KKYQGHNVDIITFNQSRYPRIIKDSLLPAPKSFDAPLQDWYPPGHGDVFESLYNSGTLDK
LLERGVEYIFLSNADNLGAVVDLRILQHMADTGAEYIMELTDKTKADVKGGTIIDYEGKA
RLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMSLRAIKRVVEENELEMEIIANEKSIPAD
KKGEADQAIYQLETAVGAAIRHFKNAHGVNVPRRRFLPVKTCSDLLLVKSDLYRLEHGQL
VMDPNRFGGVPVIKLGSDFKKVSDFQKRIPSIPRIVELDHLTITGAVNLGRNVTLKGTVI
IVATEGSTIDIPPGSVLENCVVQGSLRILEH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcttttcttcttcttcttcttcttcttcttctgcaaataagctgacccaattc
cctcgtgcgcaggccttcgagaatgcctccaccagtgtcgctgcttctcagatgcgtaac
gctctgaatgcgcttgccgagaccgttcccgaccccgaagagaagaagcgcttcgaggcc
gagatggacaacttcttcgctctcttccgcagattcctcaacgacaaggccaagggcaat
gtcgtcaactgggaccgcatcaaccctcctgcgcccaaccaggtcgtcgactacaatgac
ctgggcgccgaggcctcggtggagttcctgaacaagctggccgtcgtcaagctcaacggt
ggtcttggtacctccatgggttgcgtgggccccaagtccgtcattgaagtccgtgaaggc
atgtccttcttggatttgtccgttcgtcagattgagcacctgaaccgtacctacaacgtc
aacgtgcccttcgttctgatgaactcgttcaacaccgaccaggacacccagtccatcatc
aagaagtaccaaggccacaacgtcgacatcatcaccttcaaccagtcccgctaccctcgt
atcatcaaggactctctcctccccgctcccaagagctttgacgctcctctgcaggactgg
taccctcccggtcacggtgacgtttttgagtcgctgtacaactcgggcactctggacaag
ctgctcgagcgtggtgttgagtacatcttcctctccaatgccgacaacctcggcgccgtt
gtggatctccggattttgcagcacatggcggacactggtgccgagtacattatggagttg
accgacaagaccaaggccgacgtcaagggtggtaccatcattgactacgagggtaaggcc
cgtctgctcgaaatcgcccaggtgcccaaggagcacgtcaacgagttcaagtccatcaag
aagttcaagtacttcaacaccaacaacatctggatgagcctccgcgccatcaagcgtgtt
gttgaggagaacgagttggagatggagatcattgccaatgagaagtccatccccgccgac
aagaagggcgaggccgaccaggccatctaccagctggagaccgccgtcggtgcggccatc
cgccacttcaagaacgctcacggtgtgaacgttccccgtcgccgtttcctgcccgtcaag
acttgctccgatctcttgctggtcaagtcggatctctaccgtctcgagcacggtcagctc
gtcatggaccccaaccgtttcggcggtgtccccgtcatcaagcttggatcggacttcaag
aaggtgtcggacttccaaaagcgcatccccagcattcctcgcatcgtcgagctggaccac
ctcacaatcaccggtgctgtcaacctcggccgcaatgtcaccctgaagggtaccgtcatc
atcgtcgccaccgagggcagcacgatcgacattccccctggttcggtcctggagaactgt
gtggtccagggcagcttgagaatcctggagcactaa

DBGET integrated database retrieval system