KEGG   Aspergillus fumigatus: AFUA_7G02620
Entry
AFUA_7G02620      CDS       T01017                                 

Definition
(RefSeq) DNA-directed RNA polymerases N/8 kDa subunit superfamily
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
afm  Aspergillus fumigatus
Pathway
afm03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:afm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AFUA_7G02620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:afm03021]
    AFUA_7G02620
   03400 DNA repair and recombination proteins [BR:afm03400]
    AFUA_7G02620
Transcription machinery [BR:afm03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AFUA_7G02620
  RNA polymerase III system
   RNA polymerase III
     AFUA_7G02620
  RNA polymerase I system
   RNA polymerase I
     AFUA_7G02620
DNA repair and recombination proteins [BR:afm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AFUA_7G02620
SSDB
Motif
Pfam: RNA_pol_N
Other DBs
NCBI-GeneID: 3504192
NCBI-ProteinID: XP_746670
UniProt: Q4WAV4
Position
7
AA seq 140 aa
MIIPVRCFSCGKVVGDLWERYLQLLDDGIPDGDAMDQLGCKRYCCRRMIMTHVDLIEKLL
RYAYILLIGTILLKEIGQNLKYDVFCLPAVGFIVPTYPQYIQFALPGQLDRTTGLCPLCK
TFPTVQSLASPVSAAGHAYF
NT seq 423 nt   +upstreamnt  +downstreamnt
atgattatccctgttcggtgcttttcttgtggcaaggttgtcggtgatctttgggaacgt
tatttacagctacttgatgatggtattccggatggcgatgctatggatcagcttggttgc
aagaggtactgttgccgcagaatgatcatgacacacgtcgatctcattgaaaagcttctt
cgctatgcttatattctcctaataggtacaatcctgctgaaagagatcgggcaaaatctc
aaatatgatgttttctgtcttccggctgtgggatttattgtgcctacatacccccaatat
atccaattcgctctccctggccaacttgacagaacgaccgggttatgcccattgtgcaag
acctttcccacagtgcagagccttgctagtcccgtttctgcagcaggccacgcctacttc
tga

DBGET integrated database retrieval system