KEGG   Aspergillus fumigatus: AFUA_7G03740
Entry
AFUA_7G03740      CDS       T01017                                 

Definition
(RefSeq) 14-alpha sterol demethylase Cyp51B
  KO
K05917  sterol 14alpha-demethylase [EC:1.14.14.154 1.14.15.36]
Organism
afm  Aspergillus fumigatus
Pathway
afm00100  Steroid biosynthesis
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
Module
afm_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    AFUA_7G03740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:afm00199]
    AFUA_7G03740
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.154  sterol 14alpha-demethylase
     AFUA_7G03740
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.36  sterol 14alpha-demethylase (ferredoxin)
     AFUA_7G03740
Cytochrome P450 [BR:afm00199]
 Cytochrome P450, animal type
  CYP51 family
   AFUA_7G03740
SSDB
Motif
Pfam: p450 SCIMP
Other DBs
NCBI-GeneID: 3506370
NCBI-ProteinID: XP_749134
UniProt: E9QY26
Structure
PDB: 
6CR2 4UYM 4UYL 5FRB

Position
7
AA seq 524 aa
MGLIAFILDGICKHCSTQSTWVLVGIGLLSILAVSVIINVLQQLLFKNPHEPPVVFHWFP
FIGSTISYGIDPYKFFFDCRAKYGDIFTFILLGKKTTVYLGTKGNDFILNGKLRDVCAEE
VYSPLTTPVFGRHVVYDCPNAKLMEQKKFVKYGLTSDALRSYVPLITDEVESFVKNSPAF
QGHKGVFDVCKTIAEITIYTASRSLQGKEVRSKFDSTFAELYHNLDMGFAPINFMLPWAP
LPHNRKRDAAQRKLTETYMEIIKARRQAGSKKDSEDMVWNLMSCVYKNGTPVPDEEIAHM
MIALLMAGQHSSSSTASWIVLRLATRPDIMEELYQEQIRVLGSDLPPLTYDNLQKLDLHA
KVIKETLRLHAPIHSIIRAVKNPMAVDGTSYVIPTSHNVLSSPGVTARSEEHFPNPLEWN
PHRWDENIAASAEDDEKVDYGYGLVSKGTNSPYLPFGAGRHRCIGEQFAYLQLGTITAVL
VRLFRFRNLPGVDGIPDTDYSSLFSKPLGRSFVEFEKRESATKA
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgggtctcatcgcgttcattctcgacggcatctgcaagcattgctcaacgcagtcaaca
tgggtgcttgttggaataggactactatccatcctcgctgtatctgtcattatcaatgtg
ctgcagcagctactcttcaaaaatccccacgagcctcctgtggtcttccactggttcccc
ttcattggtagcaccatcagttatggcatcgatccgtacaagttctttttcgactgccgc
gcaaagtatggcgatatcttcacattcattctacttggcaaaaagacaacggtgtatctt
ggtacgaagggcaatgacttcatcctaaacggcaagctgcgagatgtttgcgctgaggag
gtgtattctccactcactacgcctgtttttggtcgacatgttgtgtatgactgccctaat
gctaagcttatggagcagaagaagttcgtcaaatacggtctcacctctgatgcgctccga
tcttatgttcccttaattacggatgaagtagagagctttgtcaaaaattctccggcgttc
cagggacacaagggcgtcttcgatgtatgcaaaacaatcgctgaaatcaccatttacact
gcttcgcgctcgcttcaaggaaaagaagttcgaagcaaatttgattccacattcgcagag
ttgtaccataaccttgacatgggcttcgctcctatcaacttcatgttaccctgggccccc
ctaccccacaaccgcaaaagggatgctgcgcagcgcaaattgaccgaaacttatatggaa
attattaaggcacgtcgtcaggctggcagtaagaaggattctgaagacatggtctggaac
ctcatgtcctgcgtttacaagaacggcacgccggttcccgatgaggaaatcgctcatatg
atgattgccttgttgatggcgggtcaacattcttcctcttctactgcttcctggattgtt
ctgcgccttgcgacacggcctgatataatggaagagctatatcaggaacaaattcgtgtt
ctcggatctgacttgcctccactcacgtatgacaatctgcagaagttggatttgcacgcg
aaggtcatcaaggagactctacgcttgcatgcaccgattcactcgatcattcgagcagtg
aagaatcccatggctgtggatggtacttcatatgtgatccctacatctcataatgttctc
tcttctccaggcgtcactgccaggtctgaggagcacttcccaaatccactcgaatggaac
cctcaccgttgggatgagaacattgcagctagcgctgaggacgacgagaaagttgattat
ggctacgggttagttagcaagggcaccaatagcccgtacctcccgtttggcgctggacgg
cataggtgcattggcgagcaatttgcatatcttcagcttggcacaatcactgctgtactt
gtgcggttattcagattccgtaatttgccaggtgtcgatggcatccccgacacagactac
tcttctctgttctccaaaccgcttggccgatcttttgtggagtttgaaaagcgcgagtcc
gctaccaaagcctga

DBGET integrated database retrieval system