KEGG   Aspergillus fumigatus: AFUA_7G03910
Entry
AFUA_7G03910      CDS       T01017                                 

Definition
(RefSeq) C2H2 zinc finger protein
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 Zn-ribbon_8 Rad50_zn_hook zf-Di19 DUF3268 zf-C2HE zf-C2HC_2
Other DBs
NCBI-GeneID: 3506422
NCBI-ProteinID: XP_749117
UniProt: Q4WG62
Position
7
AA seq 643 aa
MAALTQSTNEPVAISNPLSGTPSSLISSPPESVAFLKSSKQDSSLTSIASAGLNVSRSRE
SLPQMSTTAPTDGPIDRPQESEKASEQNSSLVAREALGASEKQNVGSIHDSMSMSSDHMQ
VDSAHNSGSVPDTFGADSGSTLMAAPTVASPGPIEDSTSQDGDRPRHRDDADMQESSNKA
FSYPMPTGHLGDARRGLSLPNSGFQKSGQRSPSAKKHRCPYCATEFTRHHNLKSHLLTHS
QEKPYVCQTCQSRFRRLHDLKRHTKLHTGERPHICPKCGRRFARGDALARHNKGQGGCAG
RRASMGSFAPEDDYGEGAVAPSAEDTMDGLVYAEPERMDEEDERRLNMPSIKKHDAPSDS
IPRSHSGSSYQPRQPNTYPPIAAGRPSPGGLFPPPTSHGGSSASTSPVSQSGNMTFPPPG
QPSGATVFQSTNVTESPRPLSPNALTSHQGGHGPEGGSIQLHRSHSPSMSQPFQQQPFSR
SGPSQGPVTNHSAPGLGLPPSQPGAPQLPPPPGLGPSDTRFSLHNPGSVQPPQQAATKHG
SSLGHSTNHSGSLSSKAGLDATAGNGTHLPGPHDPSFVEQSRDREDKLWAYIRSVHEELA
GLKSEVAALRSQLASSNASNLAPTNTSAASAQPESSSGSTAQR
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggctgcattgacgcaatcgactaacgagccggttgccatctcgaatcccttgtccgga
acacctagctcgctcatctcgagcccgcccgaatccgtcgcgtttctcaagtcatcgaag
caagattcgagcttgacgtccatcgccagcgccggactgaacgtctcgaggtcgagggaa
tcgttaccccagatgtccaccactgcaccgacggacggtccgatagaccgaccacaggaa
tcggaaaaggcatccgagcagaacagctcactggtagcaagagaggctttgggtgctagc
gaaaagcagaatgtcggttccatccacgactccatgtccatgtcgtcggaccatatgcaa
gtcgattcggcgcataactcgggcagcgtccccgatacttttggtgccgatagcggctcg
accctaatggccgctccaactgtggctagtccgggccccatagaggactctacctcccag
gacggtgatcgcccgcgccatcgagacgacgcagatatgcaggagagtagtaataaggct
ttctcgtacccaatgcctacgggccatctcggcgatgcgcgccgcggtctcagtctaccc
aattctgggttccaaaaaagtggccagcgatcaccgtcggccaaaaaacatcgttgtcct
tactgtgccactgagttcaccagacatcataacctcaagagccatcttctcacccacagc
caggagaagccatacgtatgtcagacttgccagtcgcgctttcggagactccatgatctc
aagagacatacaaagcttcataccggcgagcgtccacatatctgcccgaagtgtgggcgt
cggttcgcgcgcggtgatgctcttgctcgacataataaaggccagggcggctgcgccggt
cgcagagccagtatgggaagttttgcgccagaggatgattatggcgagggcgctgttgcc
cccagtgccgaagataccatggacggtctcgtttatgccgaacccgagcgaatggatgaa
gaggatgaacgccgactcaacatgcccagcatcaaaaagcatgatgccccttcagactct
attccacgctctcattctggcagcagctaccaaccgcgtcagccaaatacatatcctccg
atagctgccggcagaccctccccgggaggattattccctcctcccacaagccacggtggg
tctagtgcgtcgacatctcccgtttctcaatccgggaatatgactttcccaccgccgggg
cagccttcgggcgcgacggtgtttcagtctacgaatgttaccgagagcccacggcccctt
tcaccaaacgctcttacatcgcaccaaggcggacatggaccggagggcggcagtatccag
ttgcaccggtcacactctcccagtatgtcgcagccatttcagcagcaacccttcagccga
tccggaccttcccagggacccgtcacgaatcattccgctcctggcctggggcttcctccc
tctcaacccggcgcccctcagctgcctcctccacccgggctgggcccctcagatacgcgg
ttctcccttcacaatccaggatctgtgcagccgccgcagcaggccgctacaaagcacgga
tcttccctcggtcattctaccaatcacagtggatccctgtcttcgaaagctggcctggac
gccacagcaggcaatggcactcatcttcccggaccacatgaccccagctttgtggaacaa
agcagagaccgggaggacaagctttgggcctacatccgatcagtccacgaagaattggca
ggattgaaaagcgaagtggccgctttacgatcccagcttgcttcgtcaaatgccagcaac
ctagcgcctacgaatacaagcgccgcgtcggctcaacctgagagcagttccggtagcact
gcacagcgatga

DBGET integrated database retrieval system