KEGG   Aspergillus fumigatus: AFUA_7G05630
Entry
AFUA_7G05630      CDS       T01017                                 

Definition
(RefSeq) hypothetical protein
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: Complex1_LYR
Other DBs
NCBI-GeneID: 3506592
NCBI-ProteinID: XP_748946
UniProt: Q4WGN3
Position
7
AA seq 361 aa
MSSSPLIPPEQWRHLFRALLRECTYLPDPIARGYMHDYVVRRFRRYSDKSQSKVQDDLHR
QHLLRKTATQKLSLLKRANEGYSRPLEKVLRLSYGRSGKKRRELLGVFIVPEVPPDALAV
EGILKGPSMFEDDWKPPTIVLDLLKSQLRNAVISQLSDRPVVKTLEPPIPKENSWGKPVA
KCRRRNIRKKWYYAVLDSLLPPLPDAELDTLHGLISGRIPWTPPKRRKAVGVPLDSPSQT
SLDVTFLTGGPKKGPTFRDFVNGRPHQITRRFMQRLWRRIYCMVPRLEWDEKNQKQYFKW
ESVKPFPNISTVVKHDQEPDLFQKVDVNGRLIQGPSRGRVEVATEEYPRAPFRLVYSGPE
E
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtcctcctcaccgcttatccctcccgaacaatggcgacatctcttccgtgccttgctg
cgcgaatgcacatatctccctgatccgatcgctagaggttacatgcatgactatgtagtg
cggagatttagacgctattctgacaagtcgcaatctaaggtacaagatgatttacatcgg
cagcacctcctccgcaaaaccgcaacccagaaactgtcgttattgaagcgtgccaacgaa
ggctattctcgaccgctcgaaaaagtactccggctctcatatggacgaagtggaaagaaa
agaagggagttgttaggtgtattcattgtcccggaagtccctcccgatgccttggccgtg
gaaggcattctgaagggcccttcgatgttcgaagatgattggaaacctccgacgattgtg
ctcgatcttctaaagtctcaattgcggaatgcagttatttcacagcttagcgatcgtcct
gttgttaagactctggagccgcctatacccaaggaaaacagctggggaaagccggttgcc
aaatgtcgtcggcggaacattaggaaaaaatggtattatgctgtgcttgacagcctcttg
ccgcctctccccgacgcagagctcgatacattacatggcctgatctctgggaggatacca
tggacaccaccaaagagaaggaaagctgttggcgttcccctggactcccccagccagacc
agccttgatgtaacatttttgacaggaggaccaaaaaaggggccgacttttagggacttc
gtcaatgggcgacctcatcaaatcacacgacgattcatgcaacgactctggaggcgcatc
tactgcatggtgccgcgcttggaatgggatgagaagaaccagaaacaatatttcaagtgg
gaatcggtaaaaccctttcccaacatatctactgtcgttaaacacgatcaagagccagac
ctgttccagaaggttgatgtcaacgggagattgatacaaggtccctccaggggccgggta
gaggtggctacggaagagtatccgcgtgctcctttccgccttgtctatagcgggcctgag
gagtga

DBGET integrated database retrieval system