KEGG   Aspergillus fumigatus: AFUA_7G05660
Entry
AFUA_7G05660      CDS       T01017                                 

Definition
(RefSeq) translation elongation factor eEF-3
  KO
K03235  elongation factor 3
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:afm03012]
    AFUA_7G05660
Translation factors [BR:afm03012]
 Eukaryotic type
  Elongation factors
   AFUA_7G05660
SSDB
Motif
Pfam: ABC_tran 4HB SMC_N AAA_21 AAA_23 AAA_28 AAA_29 AAA PduV-EutP DUF5906 AAA_16 RsgA_GTPase MMR_HSR1 AAA_22 AAA_18 RNA_helicase AAA_14 AAA_27 AAA_30 DUF87 Dynamin_N NACHT AAA_13 MeaB ATP-synt_ab NB-ARC
Other DBs
NCBI-GeneID: 3506589
NCBI-ProteinID: XP_748943
UniProt: Q4WGN6
Position
7
AA seq 1065 aa
MPAVDVSSVPVVSGKETAQAVAVLEDLIKNLNISTSADEVHAATGNLATYFSGPIPEQTL
PLKAVEVFQKQLNNKKDATARERACEAIRAIASHQTIAPGVEPHLVSLLGPVLAASGDKM
TAVQKAAQSAALAIVQAINANAVKAVVPVILNSLQNAQKWQEKMCALDCLNCLVESAPAQ
LSFRVPDLIPAVSEAMWDTKADIKKAAYSTMEKVCGLIVNKDIERFIPELIKCIAKPENV
PETVHLLGATTFVSDVTGPTLAIMVPLLDRGLVERETAIKRKSAVIVDNMCKLVEDPQIV
APFLPKLMPRLEKNYETLADPEAREKTKQALDTLIRVGDVKDGKIPEISTAGDVETVAAI
LKDILSPKYKAQIEKSEAIINYVGAIAGQLVDEKDAEVTSWTQNALPYITAIIGEEEAKA
IAETLRKRASPGAAEEDAVLSDEEEGEDLCNCTFSLAYGAKILLNQTSLRLKRGQRYGLL
GPNGTGKTTLMRAINNEQLEGFPKKDEVKTVYVEHDLDAADTEQTVIGWTMKKLRDVGID
IPQSDVEAKLEEFGFLREQFENPITSLSGGWKMKLALARAVFENPDILLLDEPTNHLDVK
NVAWLENYLCNSPCTSIIVSHDSKFLDNVIQHVVHYERFKLKRYRGNLSEFVKKVPSARS
YYELSASDMEFKFPEPGFLEGVKTKAKAIIRVSNMSFQYPGTPKPQLTDITFQVSLGSRI
AVIGPNGAGKSTLVNVLTGELIPTSGEVYQHENIRIAYIKQHAFAHIDNHLDKTPSEYIQ
WRFQTGEDRETMDRANKIVTEDDEKAMDKIYKIDGTLRRVIGIHARRKFKNSYEYECSFA
LGENVGMKSEKWTPMMSNDNAWIPRSEIIQSHAKMVAEVDQKEALASGQFRPLVRKEIEA
HCANFGLDAELVSHSRMRGLSGGQRVKVVLAACSWQRPHVIVLDEPTNYLDRDSLGALSK
ALKTFEGGVVIITHSREFTENLTEEVWAVMDGKMTPSGHNWVQGQGSGPRLEDKEGPTEV
TDAFGNKSVVEKKKKLSSAEMRKKRKERLARKKRGEEVFSDEDDI
NT seq 3198 nt   +upstreamnt  +downstreamnt
atgcctgctgttgatgtttcttccgttcctgtcgtctctggcaaggagactgcccaggct
gtcgccgttctcgaggacttgattaagaacctcaacatctcgacaagcgctgacgaggtt
cacgctgccactggcaacctcgccacctacttcagcggtcctatccctgaacagactctg
cctctcaaagctgtcgaggtattccagaagcagcttaacaacaagaaagatgccacggct
cgtgagcgtgcttgcgaggccatccgcgctatcgcctcccaccagaccatcgctcctggt
gttgagccccacctcgtctctcttctcggccccgtcctcgctgcttccggtgacaagatg
actgccgttcagaaggctgcccagtctgccgccctcgccatcgtgcaggctatcaacgcc
aacgctgtcaaggctgttgtgcctgtcattctgaactctctgcagaacgcccagaagtgg
caggagaagatgtgtgctctcgactgcctcaactgcctggtcgagtccgctcctgctcag
ctttccttccgtgtgcctgacctgatccccgctgtttccgaggccatgtgggacacgaag
gccgatatcaagaaggctgcctattccaccatggagaaggtttgcggtctgattgtcaac
aaggatattgagcgcttcattcccgagctcatcaagtgtatcgccaagcctgagaacgtt
cccgagactgttcacttgctcggtgccaccactttcgtttccgatgtcactggccctacc
ctcgccatcatggtccctctgcttgaccgtggtctcgttgagcgcgagactgccatcaag
cgtaaatccgccgtcattgtcgacaacatgtgtaagctcgtggaggacccccagattgtc
gctcccttcttgcccaagttgatgccccgtctcgagaagaactacgagaccttggccgac
cccgaggcccgtgagaagaccaagcaggccttggacaccctcattcgtgttggtgatgtt
aaggatggcaagatccccgagatctcaactgccggtgacgttgagaccgttgctgctatc
ctgaaggatatcctctcccccaagtacaaagctcagattgagaagtctgaggccatcatc
aactatgtcggtgccatcgctggtcagctcgttgacgagaaggacgccgaggtcaccagc
tggacccagaacgctcttccctacatcaccgccatcattggtgaggaggaagccaaagcc
attgccgagactctgcgcaagcgtgcctctcctggcgctgccgaggaggatgccgttctt
tctgacgaggaggagggtgaagatctctgcaactgcaccttctctcttgcatatggtgcc
aagatcctgctgaaccagacctccctccgcctgaagcgtggtcagcgttacggtcttctc
ggacctaacggtaccggtaagactactctgatgcgtgccatcaacaacgagcagcttgaa
ggtttcccgaagaaggacgaggtcaagactgtctacgttgagcacgacttggatgccgcc
gacactgagcagaccgtcattggctggaccatgaagaagctccgtgatgtcggtatcgac
atccctcagtccgatgtcgaggcgaagctcgaggagttcggtttcttgcgtgagcagttc
gaaaaccccatcacctctttgtctggtggttggaagatgaagctggctctggcccgtgcc
gtgttcgagaaccccgacattctgctccttgatgagcctaccaaccacttggacgtcaag
aatgttgcctggttggagaactacctttgcaactccccttgcacctccatcatcgtctcc
cacgacagcaagttcttggacaatgttatccagcacgttgtccactacgagcgctttaag
ctcaagcgttatcgcggcaatctgagcgagttcgtcaagaaggtccccagtgctcgttcc
tactacgagctcagcgcctccgacatggagttcaagttccccgagcctggtttccttgag
ggtgtcaagaccaaggccaaggccatcatccgtgtcagcaacatgtccttccagtacccc
ggcactcccaagccccagctcacagacatcaccttccaagtttctctgggatctcgtatt
gctgtcatcggtcccaacggtgccggtaaatccactctcgtcaatgtcctgactggtgag
ctcatccccaccagcggtgaggtctaccagcacgagaacatccgtatcgcctacatcaag
caacatgctttcgctcacatcgataaccacctcgacaagactccctctgagtacattcag
tggcgtttccagaccggtgaggaccgtgagaccatggaccgcgccaacaagatcgtcacc
gaggatgatgagaaggccatggacaagatctacaagatcgacggcaccttgcgtcgtgtt
atcggtatccacgctcgtcgtaagttcaagaacagctacgagtacgagtgctcgtttgct
cttggtgagaacgtcggcatgaagagtgagaagtggacccctatgatgagcaatgacaac
gcctggattcctcgtagcgagattatccagtcccacgccaagatggttgccgaggttgac
cagaaggaagcccttgccagcggtcagttccgtcccctggtccgcaaggagattgaggcc
cactgtgccaacttcggtctcgatgccgaactcgtttctcactctcgtatgcgcggtctg
tccggtggtcagcgtgtcaaggtcgtcctcgccgcctgctcgtggcagcgtcctcacgtc
atcgtcctcgacgagcccaccaactatctcgaccgtgactctctgggtgccctgtccaag
gctctcaagactttcgagggtggtgtcgttatcattacccactcccgtgagttcaccgag
aacctgaccgaggaagtctgggctgtcatggatggcaagatgactccttccggccacaac
tgggttcaaggtcaaggatctggtcctcgtctggaagacaaggaaggtcccaccgaagtt
acggatgcctttggcaataagagtgtcgtcgagaagaagaagaagctctcaagtgctgaa
atgagaaagaagcgtaaagaacgtttggccagaaagaagcgtggagaggaggttttctct
gacgaggatgatatttaa

DBGET integrated database retrieval system