KEGG   Aspergillus fumigatus: AFUA_8G03930Help
Entry
AFUA_8G03930      CDS       T01017                                 

Definition
(RefSeq) Hsp70 chaperone (HscA)
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
afm  Aspergillus fumigatus
Pathway
afm03040  Spliceosome
afm04141  Protein processing in endoplasmic reticulum
afm04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:afm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    AFUA_8G03930
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AFUA_8G03930
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AFUA_8G03930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:afm01009]
    AFUA_8G03930
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:afm03041]
    AFUA_8G03930
   03009 Ribosome biogenesis [BR:afm03009]
    AFUA_8G03930
   03110 Chaperones and folding catalysts [BR:afm03110]
    AFUA_8G03930
   04131 Membrane trafficking [BR:afm04131]
    AFUA_8G03930
   03051 Proteasome [BR:afm03051]
    AFUA_8G03930
   03029 Mitochondrial biogenesis [BR:afm03029]
    AFUA_8G03930
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afm04147]
    AFUA_8G03930
Protein phosphatases and associated proteins [BR:afm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AFUA_8G03930
Spliceosome [BR:afm03041]
 Complex B
  Other components
   Prp19 complex
    AFUA_8G03930
 Complex C
   Prp19-CDC5 complex
    AFUA_8G03930
Ribosome biogenesis [BR:afm03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    AFUA_8G03930
Chaperones and folding catalysts [BR:afm03110]
 Heat shock proteins
  HSP70 / DNAK
   AFUA_8G03930
Membrane trafficking [BR:afm04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    AFUA_8G03930
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    AFUA_8G03930
Proteasome [BR:afm03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    AFUA_8G03930
Mitochondrial biogenesis [BR:afm03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    AFUA_8G03930
Exosome [BR:afm04147]
 Exosomal proteins
  Proteins found in most exosomes
   AFUA_8G03930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 3504977
NCBI-ProteinID: XP_747200
UniProt: Q4WCM2
Position
8
AA seq 614 aa AA seqDB search
MSDEVYEGAIGIDLGTTYSCVANYEGTNVEIIANEQGSYTTPSFVSFTEKERLIGEAAKN
QAAMNPKNTIFDIKRLIGRRYEDPIVKKDIESWPFKVVDQGGNPVVEVEYLGETKTFSPQ
EISSMVLMKMKEVAETKLGKKVEKAVITVPAYFNDNQRQATKDAGAIAGLNVLRIINEPT
AAAIAYGLGSGKSEKERNVLIYDLGGGTFDVSLLNIQGGVFTVKATAGDTHLGGQDFDTN
LLEHFKKEFQKKTGKDLSGDARALRRLRTACERAKRTLSNATQTTVEIDSLFDGEDFNSS
ITRARFEDLNAKAFSGTLEPVQQVLKDSGLEKSQVDEIVLVGGSTRIPRIQKLLSDFFDG
KKLEKSINPDEAVAYGAAVQAGILSGKATSAETQDLLLLDVVPLSLGVAMEGNIFAPVVP
RGQTVPTIKKRTFTTVVDNQTTVQFPVYQGERTNCADNTSLGEFTLAPIPPMKAGEAALE
VVFEVDVNGILKVTATEKSSGRSANITISNAVGKLSTTEIEQMINDAAKFKSSDEAFTKK
FESRQQLESYISRVEEIISDPTMSLKLKRGNKEKIESALSDAMAQLEIEDSAPEDYKKKE
LALKRLITKAMATR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgaagtctacgaaggcgccatcggcattgaccttggcacaacctactcctgc
gttgccaactatgaaggcaccaacgttgagatcattgccaacgagcagggtagttacaca
accccgtcattcgtttctttcaccgagaaagagcgcttgattggtgaggcagccaaaaac
caggcggcgatgaaccccaagaacaccattttcgacatcaagcgtctcattggtcgacgt
tatgaagatcctatcgtgaagaaggatattgagtcgtggcctttcaaggtagttgaccag
ggcggaaaccccgttgtcgaggttgaatatttgggtgaaaccaagacattttctccccag
gaaatctcttctatggtcttgatgaagatgaaagaagtcgcagagaccaagcttggaaag
aaggttgagaaggctgtcatcaccgtaccagcttatttcaacgataatcaacgtcaggcg
acgaaggacgcaggtgccattgccggtttaaatgttctccgcatcatcaatgagcccact
gccgccgctatcgcctatggactcggctccggaaaatccgaaaaagagcgtaatgtcctg
atctatgatcttggtggaggtactttcgatgtgtctcttctcaacatccaaggaggtgtt
ttcactgtcaaggccacagccggtgatactcatctcggtggacaagattttgacaccaac
ctccttgaacacttcaagaaggaattccagaagaagactggaaaggatctctcaggcgat
gccagagctcttcgccgtttgagaacggcctgcgagcgtgccaagcgtacactgtccaac
gctacacagacaactgttgagattgactctttgttcgatggagaggatttcaactcgtct
atcactcgtgcccgctttgaggatctcaacgccaaggctttctctggcacgctcgagcca
gtacagcaagttctcaaggactctggccttgagaagagccaggtcgatgagattgtgctc
gttggtggctccactcgtatccctcgaatccagaagctgctcagtgactttttcgatggt
aagaagcttgagaagagcattaacccagatgaagctgtagcttatggtgccgccgtgcaa
gctggcatcctttctggtaaggccacctcggctgaaactcaggacttgctgcttctggat
gtcgttcccctttcccttggagttgccatggaaggcaatattttcgccccggttgttccc
cgcggtcaaactgttcccaccatcaagaagcgcacctttacgactgttgtagacaaccag
acgaccgttcagttcccagtttatcagggtgagcgcacaaactgtgctgacaacacctcc
ctgggcgagtttactctcgctcctatccctcccatgaaggctggcgaggccgctcttgaa
gttgttttcgaggtcgatgtcaatggtatccttaaggtcaccgctacggagaagtcttct
ggccgttccgccaatattactatctccaacgctgttggcaagctctccaccactgaaatc
gaacagatgattaatgacgccgccaagttcaagtcgagcgacgaggcctttaccaagaaa
ttcgagtctcgtcagcagctcgaatcttatatctctcgcgtcgaagagatcatctcagac
cccaccatgtctctgaagctcaagcggggcaacaaggaaaagatcgagtctgctctaagt
gacgctatggctcaacttgagatcgaagactctgcccctgaggattacaagaagaaggaa
ctcgccctcaagagactcatcaccaaagctatggccacccggtaa

DBGET integrated database retrieval system