KEGG   Aspergillus fumigatus: AFUA_8G04670
Entry
AFUA_8G04670      CDS       T01017                                 

Definition
(RefSeq) serine/threonine protein kinase
  KO
K08856  serine/threonine kinase 16 [EC:2.7.11.1]
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:afm01001]
    AFUA_8G04670
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AFUA_8G04670
Protein kinases [BR:afm01001]
 Serine/threonine kinases: Other
  NAK family [OT]
   AFUA_8G04670
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH NFACT-C
Other DBs
NCBI-GeneID: 3504748
NCBI-ProteinID: XP_747273
UniProt: Q4WCE9
Position
8
AA seq 426 aa
MAQYFFDLLYNFTDCMCCFPSTPQLKINNRSFKLLRLLGEGGFSYVYLVQDKATSELFAL
KKIRCPFGQESVSQALKEVEAYSLFTSQPNIIHSIDHCVSTDSGSKFRSDGGEPGSKTVY
ILLPYYQRGNLQDAINANLVNHTRFPEKRLMVLMLGVANALKAMHQYRVKSGAGSTRRAK
AVRREGEAADAQLSMQMGKPKRRASQRVDEEDSENEPLMDDEVTISQEGVQEGDLRPYAH
RDIKPGNIMIDDDGQTPILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFD
VKTGSIIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKPGAT
KGKGRAGAEDAGKDNTATISEPVKEVVRKCLQVEPADRPDIDELIQIIKDVIKDLSDDDV
IASGSA
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggctcagtatttctttgatctgctctacaactttacagattgcatgtgctgctttccg
agcacgccgcagttgaaaatcaacaatcgtagcttcaaattattacggcttcttggtgaa
ggtggattttcctacgtttaccttgtccaagataaggcgacatcggagctcttcgccttg
aagaaaatccggtgtccattcggccaagaatctgtatcacaagctttgaaagaggtcgaa
gcctacagcctattcacatcacaaccgaacatcatccattcgatagaccattgcgtatct
acggactcgggctcaaagtttcgttccgatggcggcgaaccaggatcgaaaaccgtctac
atcctgctcccctactaccaacgcgggaatcttcaagatgcaatcaatgcaaatctcgtg
aatcatactcggtttcccgaaaagaggctaatggtgcttatgctcggtgtcgccaacgcg
ctaaaagccatgcaccagtatcgggtaaagagtggcgctgggtctacgcgcagagccaaa
gcggtcagacgcgagggcgaggcggcagatgcacaattgtcaatgcaaatgggcaagccg
aagcgtcgagcaagccagagagtagacgaagaagattcagaaaacgagccgttgatggat
gacgaggttactataagccaggagggagttcaggagggagaccttcgcccttatgcgcat
agggacatcaaacctggtaatatcatgatcgacgatgacggtcagactccgatcctcatg
gatctcggctccctagcgcccagtcccattgctatcacctcccgttcactagctctggcc
gtccaagatactgctgcagagcacagtaccatgccgtaccgggcgcctgagctatttgac
gtcaagaccgggtcaatcattgataccaaggtcgatatctggtccttgggatgcacattg
tacgcctgccttgtagggaaaagcccctttgaggcccgaagcgaggagaccggcggtagc
ctcagtatgtgtgtattggggggggactggcggtttccggacgagaagcccggggccacc
aagggtaaaggccgagctggagctgaggatgcgggtaaagacaacactgcaaccattagc
gagccagtgaaagaggttgtccggaagtgtctacaggttgagcctgctgaccgtcccgac
atcgatgagctcattcagatcataaaggatgtgatcaaggacctttccgatgacgatgtc
atcgcttcagggtcagcctaa

DBGET integrated database retrieval system