KEGG   Aspergillus fumigatus: AFUA_8G05610
Entry
AFUA_8G05610      CDS       T01017                                 

Definition
(RefSeq) cell wall glucanase (Scw11)
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: Glyco_hydro_17
Other DBs
NCBI-GeneID: 3504706
NCBI-ProteinID: XP_747362
UniProt: Q4WC60
Position
8
AA seq 616 aa
MITSIPPKSLPSQEIKRGHRAPSFKSALSTTASLVQRAFLGLCNIFTFLSTMRGAILATA
AALAGTAMADVAHMRRHGHDSFHQRRSPLAEADATCGCTTEVVTVWGPPTLIPVASPTPS
TVTSEAVTTLHSTSTTTVTVIASASTPAASPSPATDKVPLPTPAITNFPSTGVYTIPATT
VTVFDTTTVCGATTTELPAGTHTYGGVTTVVETATTVVCPYATVEPSGTTVTSVIKTTTY
VCPSAGTYTIAPTTTTVPTSTVIVYPTPAVITPGTYTQPEQTVTVTRTDYTYVCPFTGQD
EPTSAPAAPSTTAVPATTTAAPETTTAAPDTTTAVPSTSSAAPSSSSTAPASTGAVSGQM
GMTYTPYTKGGDCKDKSSVLSEVAALKSKGFTHVRVYSTDCNSLEYIGEAARTSGLQMII
GVFISSTGVSGAQDQVTAISKWAQWDLVSLIVVGNEAIQNGYCDASTLAGFISSAKSAFQ
AAGYTGKVTTTEPINVWQAHGSTLCGVCDIVGANIHPFFNADVSADQAGKFVAQEIKVLE
SICPGKDVLNLETGWPHAGNANGKAVPGTSEQAIAIKSIADEVGSKSVFFSYFDDLWKEP
GQFGVERYWGCFDTFN
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgatcacatcaattcctcctaagtctcttccatctcaagaaatcaaaagaggccaccgc
gccccctcctttaaaagcgctttatccactaccgcttcactcgttcagcgggcattcctt
ggactctgcaatatctttacattcttatccaccatgaggggtgctattctggccaccgcg
gccgctcttgcgggcaccgccatggccgatgtcgcacacatgcgtcgtcacggccatgat
tctttccaccagcgtcgttctcctctcgccgaagctgatgctacctgcggctgcaccacc
gaggtcgtcactgtctggggtccccctactctgatccccgttgcgtctcccactcccagc
accgtcacttccgaggctgtcaccactttgcactcgaccagcaccaccaccgtgactgtt
attgccagtgcctccactcccgcggccagcccgagcccggctaccgataaggtccctctg
cccactcctgccatcaccaacttcccctcgactggtgtctacaccattcccgccaccact
gtgaccgtcttcgacacaaccaccgtgtgcggagccaccactaccgagctgcctgctggt
actcacacctacggtggtgtcaccactgtggttgagaccgcgaccactgttgtctgcccc
tacgccaccgtcgagccctctggcaccaccgtgaccagcgtgatcaagaccaccacctat
gtctgcccctctgctggcacctacaccatcgctcccaccaccaccaccgtccctaccagc
accgtcattgtctaccccactcccgccgtcatcactcctggtacctacactcagcctgag
cagactgtgaccgtcacccgcaccgactacacctatgtctgccccttcaccggccaggac
gagcccacctctgctccggctgcccctagcaccactgccgtccctgccaccaccaccgcc
gctcccgagaccaccaccgccgctcctgacaccaccaccgccgtgccttccaccagctct
gctgcgccctccagctccagcacagcccctgcttccaccggtgccgtcagcggccagatg
ggtatgacctacacgccttacaccaagggtggtgactgcaaggacaaatcctccgtcctc
tccgaggtcgctgccctcaagtccaagggtttcacccacgtccgtgtctactcgaccgac
tgcaacagcttggagtacattggtgaggccgcccggacttctggtctccagatgatcatt
ggtgtcttcatcagcagcactggtgtctctggtgcccaggaccaggttaccgctatctcc
aagtgggcccagtgggacctcgtcagcctgatcgtcgtcggtaatgaggctatccagaac
ggctactgcgatgcttccacccttgccggcttcatctcctctgccaagtccgccttccag
gcggccggctacactggcaaggtcaccaccaccgagcccatcaacgtctggcaggctcac
ggctccactctgtgcggtgtttgcgacatcgtcggtgccaacatccaccccttcttcaac
gccgatgtctccgccgaccaggccggcaagttcgttgctcaggagatcaaggtccttgag
agcatctgccctggcaaggatgttctcaacctggagaccggctggcctcacgctggtaac
gccaacggcaaggctgttcccggtacctccgagcaggctatcgccatcaagtccattgcc
gacgaagtcggctccaagtctgtcttcttctcctactttgatgacctctggaaggagccc
ggtcagttcggtgtcgagcgctactggggttgcttcgacaccttcaactaa

DBGET integrated database retrieval system