KEGG   Aspergillus fumigatus: AFUA_8G05820
Entry
AFUA_8G05820      CDS       T01017                                 

Definition
(RefSeq) DNA mismatch repair protein
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 3504771
NCBI-ProteinID: XP_747384
UniProt: Q4WC38
Position
8
AA seq 882 aa
MPIKALPQTTVRAIGSTSVISDPCSIVKELLDNSLDAHATAISVEISQNTVDVIQVKDNG
HGIPAEDHPFVCRRAFTSKIATVEDLRKLGGKSLGFRGEALASAAEVCGGVTVTTRVEAD
PVGFCIKYGRNGELISTQRASHPVGTTVRVTDLFKSIPVRRQTVLKSTAKTVAKIKKIVQ
SYAIAQPTIRLSLKVLKAANEKANWVFAPGKNASLTDAALKVAGTEVASACVTKPWPCAN
ESGEESRVVNGSSFQLMALLADPGSDFSKVNNAGQFFSVDGRPLSASRGIGQEISKLYKT
YLRAAASRSGGFPYISDPFLCLQIRCPEASYDVNVEPAKDDVLFENQQDLLSLAEELFKD
VYGETLDRHEKHKSSSKGKERMVNSDAFELLLARKDSTECSAETVSEGNKPPSFVTASSL
FHMRSSPKHGRHEQRLFSDGSPGASGYTRTRDLEGLNPWSVTRLYAPSGALSHKTPARVL
TGSARLPPAAQEQESRSMTESSPLRLASSASPSTSTPGSNRLSHSPAESHSSASVSDLAQ
TSPITPLHGPSVRSRALRQRDRERYGNGALDTWFMKTTQASSRQEPVEQCPENEHDEPPL
SQLAEDRFAQRERPPATSDTATPRGSAVAAGSLEPSEDETSVVSRSRASEPASRRLDQWS
AKLHRLASADHNLELERALDFEKRKREVITRLREQRKDASAANSPHVSRYLAAKAALQPD
VNNNNAGPAPPISETDNPSPRLNPHDPRSYLMRNKPSHDKRRLASDPAKIRRIQTNKLPF
EKIPDGCELHDLCLVQSADISLISETFCNLYEHDLYIREGDNFAGFTDADLQSLSLWESQ
LSSLIKQQFRTTDGSDMPTIQINFDLHQHLSDFDMESSSASA
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgccgatcaaggcccttccccagaccactgttcgagcaattggctcaacttcagtcatt
tcagacccctgctccattgtcaaggagttgctggacaattcacttgatgcacacgccact
gcaatttctgtagaaatctcccagaacacagtcgatgtgatccaagtgaaggacaatgga
catgggattccagccgaagatcatcctttcgtctgtagacgtgcctttactagcaagatc
gcgactgtcgaggatctgaggaaactcggcggaaaatcgctaggctttagaggtgaagcg
ttagcaagtgctgccgaagtttgcggaggagtgacagttaccaccagagttgaagcggac
cctgttggcttctgcatcaaatatgggcgaaatggggagctcatcagtactcaacgtgcc
tcgcacccagtcggtacaacggtgcgagttacggatctcttcaagagcataccagtccgc
aggcaaacagtattgaaaagcaccgcaaagacagtagccaagattaaaaagatcgtacag
tcatatgctatcgctcagcccactattaggctctccctgaaggttcttaaagctgctaac
gaaaaggccaactgggtcttcgcccctggaaaaaatgcctcgcttacggacgcagcactc
aaagttgccggcactgaggtcgcttctgcttgcgtaaccaagccgtggccgtgcgcaaac
gagtccggtgaggaatctagagttgtcaatggctcttcttttcagctgatggccctactt
gcggatcctggatcagatttctccaaagtgaacaatgcaggacagtttttcagtgtggac
ggcagacctctctcagcatcccgaggcattggacaggagatctcaaaactgtacaagacc
tatctgcgagccgctgcttcccgtagcggcgggttcccatacatatcagatccattcctt
tgcttgcagatccgctgcccagaagccagctacgatgtgaatgttgaaccggccaaggac
gatgttttattcgagaatcagcaagaccttctctcgcttgcagaagaactcttcaaggac
gtttacggtgaaaccctggacaggcacgagaagcacaaaagctcctccaaagggaaagaa
aggatggtaaatagtgatgccttcgaactacttttagctcgtaaagacagcactgaatgt
tctgccgagactgtgagtgagggcaacaagccaccaagcttcgtcacggctagttcgctt
ttccacatgaggagcagtccgaagcatggccgacacgaacagcgattattctccgatgga
agtccaggagcgtccggatacacgcgaaccagagatctagagggtctcaacccatggtca
gtgacgcgactgtatgctccttctggagctctatctcataaaactccggcgagggttcta
acaggctccgcacggctgcctcctgccgcgcaggaacaagaatccaggtctatgaccgag
tcatctccgttgcgcttagcaagttccgcttcgccgagtacatccacgcctggttcgaat
cgactgtcacactctccagccgagtctcactcttctgcttcggtctccgacctggcacaa
acttctccaatcacgccattacacggcccctctgtacgatcaagagccctaaggcaacgc
gacagggagcgttacggtaatggtgctcttgatacatggtttatgaagaccacacaagca
tcatcccgtcaagagccggttgagcagtgtccggaaaacgaacatgatgagcctccgttg
tcgcagctggcggaggaccgattcgcacaacgtgaacgtccgccggccacttcagacaca
gcgacccctcggggttccgctgtggcagcaggaagcctagaaccatctgaggacgagacg
tcagtcgtcagccggagtcgtgcctcagagcctgcatcgagacggctggaccaatggtct
gcaaaactgcacagacttgcgagtgctgaccataacctcgagttggaaagagcacttgac
tttgagaagcgcaagagagaagtgatcacaaggctccgcgagcagagaaaggatgcgtcc
gctgcaaattcacctcatgtgagcagatatcttgctgccaaagccgctttgcagcccgat
gtcaataacaacaatgcggggccagcgccaccgatctctgaaactgacaacccaagtcct
cgtctaaacccgcatgatccgaggtcttatctcatgcgcaataaaccctcccatgacaaa
aggaggcttgcctcagacccagccaaaatccgacgaattcaaacaaacaagttgcctttc
gagaagatacccgacgggtgcgaattgcatgatttatgcctggtgcagtctgcagacatc
tccctgatttccgagaccttttgcaatctctatgaacatgatctatatatacgagagggc
gataattttgcagggtttactgacgcggatctgcagtccctgagcttgtgggagagccaa
ttgtcctcgttaatcaagcaacaattccgaactacagacggttcagacatgcctaccatt
cagataaacttcgatctacatcagcatctgagtgattttgacatggagagctcatctgca
tctgcatga

DBGET integrated database retrieval system