KEGG   Acidaminococcus fermentans: Acfer_0031Help
Entry
Acfer_0031        CDS       T01151                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00471  D-Glutamine and D-glutamate metabolism
afn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Acfer_0031
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:afn01011]
    Acfer_0031
Enzymes [BR:afn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Acfer_0031
Peptidoglycan biosynthesis and degradation proteins [BR:afn01011]
 Precursor biosynthesis
  Racemase
   Acfer_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ADB46440
UniProt: D2RMW0
Position
35919..36713
Genome map
AA seq 264 aa AA seqDB search
MNRLDPIGVIDSGVGGLTVLKWLQEKMPHERFIFIGDTARTPYGNRSREEIQGFVGEMTA
WLNRRNIKQLVVACNTITVLGTDVIKNGYDFSVIGMKKGAHMVEGVTRNKKVGFLATDFT
VASGAHKKEIQEMDPEIQVFGQGCPKFVPLIEGEQFGSPELAAAIKEYTDKLKEYDVDTV
MLSCTHYPFVEKEIREAFGPGVTILDPAERTVQAAMEDLKQRRLNRETGLGRAEVCFTAD
LERGKRLAARMLDMNQCDFRLIHL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacagactagatcccattggtgttatcgattccggggtggggggactgacggtcctg
aagtggctccaggagaagatgccccatgaacggttcattttcatcggggatacggcccgt
actccctacggcaaccggtcccgggaagaaatccagggatttgtgggagaaatgaccgcc
tggctgaaccggcggaacatcaaacagctggtggtggcctgcaacaccattacggtactg
ggcaccgacgtgatcaaaaacgggtatgatttctccgtcatcggcatgaaaaaaggggcc
catatggtggaaggggtcacccgaaacaaaaaagtgggattcctggccacggatttcacg
gtggcttccggggcccacaaaaaggaaatccaggaaatggatccggaaatccaggtgttc
ggccagggttgtcccaaattcgtcccgctcattgaaggggaacagttcggcagtccggaa
ctggcggcggccatcaaagaatatacggataaactgaaggaatatgatgtggatacggtg
atgctctcctgtacccattatccctttgtggaaaaggaaatccgggaagccttcgggccc
ggggtcaccatcctggatccggcggaacggacggtccaggcggccatggaagacctgaag
cagcggcggctgaaccgggaaaccggcctgggccgggcggaagtgtgtttcaccgccgac
ctggaacggggcaagcgcctggcagcccggatgctggatatgaaccagtgtgatttccgg
ctgatccatttgtga

DBGET integrated database retrieval system